Advanced Search (OLGA)

Gene: Hsbp1 (heat shock factor binding protein 1) Rattus norvegicus

Analyze

Symbol:

Hsbp1

Name:

heat shock factor binding protein 1

RGD ID:

628632

Description:

Predicted to enable identical protein binding activity. Involved in muscle contraction. Predicted to be located in axon cytoplasm. Predicted to be active in cytosol and nucleus. Orthologous to human HSBP1 (heat shock factor binding protein 1); INTERACTS WITH (+)-pilocarpine; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

heat shock factor-binding protein 1; Hsp25

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HSBP1 (heat shock factor binding protein 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hsbp1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hsbp1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HSBP1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HSBP1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hsbp1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HSBP1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HSBP1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hsbp1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Hsbp1 (heat shock factor binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HS6ST3 (heparan sulfate 6-O-sulfotransferase 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	HSBP1 (heat shock factor binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HSBP1 (heat shock factor binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hsbp1 (heat shock factor binding protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hsbp1b (heat shock factor binding protein 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	hsbp1b (heat shock factor binding protein 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hsbp1a (heat shock factor binding protein 1a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	hsbp1a (heat shock factor binding protein 1a)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	hsb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hsb-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5446	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG5446	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hsbp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	hsbp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,309,703 - 64,314,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,309,703 - 64,314,035 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,401,039 - 47,405,373 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,400,966 - 47,435,821 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,195,408 - 54,199,740 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,875,905 - 54,880,295 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,090,522 - 57,094,858 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	51,985,196 - 51,989,528 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	51,985,170 - 51,989,544 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,733,736 - 62,738,068 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,589,574 - 49,594,599 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,660,240 - 46,664,572 (+)	NCBI		Celera
RGSC_v3.1	19	49,594,451 - 49,599,480 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

ethanol (ISO)

fenthion (ISO)

fluoranthene (ISO)

folic acid (ISO)

fonofos (ISO)

gold atom (ISO)

gold(0) (ISO)

hydralazine (ISO)

hydrogen sulfide (ISO)

indirubin (ISO)

indometacin (EXP)

ivermectin (ISO)

menadione (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

miconazole (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (ISO)

nitrates (ISO)

ozone (EXP)

paracetamol (ISO)

parathion (ISO)

piroxicam (ISO)

reactive oxygen species (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axonal transport of mitochondrion (IEA,ISO)

cellular heat acclimation (IBA)

endodermal cell differentiation (ISO)

muscle contraction (IDA)

negative regulation of DNA-templated transcription (IEA)

Cellular Component

axon cytoplasm (IEA)

cytosol (IBA)

nuclear speck (IEA,ISO)

nucleus (IBA,IEA)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

transcription corepressor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Cytoskeletal disruption and small heat shock protein translocation immediately after lengthening contractions.	Koh TJ and Escobedo J, Am J Physiol Cell Physiol 2004 Mar;286(3):C713-22. Epub 2003 Nov 19.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18156166	PMID:18583709	PMID:24380799	PMID:25416956	PMID:36321738

Genomics

Comparative Map Data

Hsbp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,309,703 - 64,314,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,309,703 - 64,314,035 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,401,039 - 47,405,373 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,400,966 - 47,435,821 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,195,408 - 54,199,740 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,875,905 - 54,880,295 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,090,522 - 57,094,858 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	51,985,196 - 51,989,528 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	51,985,170 - 51,989,544 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,733,736 - 62,738,068 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,589,574 - 49,594,599 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,660,240 - 46,664,572 (+)	NCBI		Celera
RGSC_v3.1	19	49,594,451 - 49,599,480 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

HSBP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	83,807,978 - 83,819,737 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	83,719,311 - 83,819,737 (+)	Ensembl			hg38	GRCh38
GRCh37	16	83,841,583 - 83,853,342 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	82,399,094 - 82,404,095 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	82,399,093 - 82,404,095	NCBI
Celera	16	68,142,699 - 68,147,697 (+)	NCBI		Celera
Cytogenetic Map	16	q23.3	NCBI
HuRef	16	69,593,015 - 69,598,111 (+)	NCBI		HuRef
CHM1_1	16	85,252,863 - 85,257,959 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	89,873,707 - 89,885,464 (+)	NCBI		T2T-CHM13v2.0

Hsbp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	120,071,277 - 120,075,668 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	120,071,227 - 120,075,661 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	119,344,538 - 119,348,929 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	119,344,488 - 119,348,922 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	121,868,438 - 121,872,829 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	122,230,515 - 122,234,906 (+)	NCBI		MGSCv36	mm8
Celera	8	123,560,285 - 123,564,676 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	67.54	NCBI

Hsbp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955564	396,133 - 401,251 (-)	Ensembl
ChiLan1.0	NW_004955564	396,985 - 400,975 (-)	NCBI	ChiLan1.0	ChiLan1.0

HSBP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	93,552,976 - 93,558,004 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	99,471,430 - 99,476,467 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	64,429,442 - 64,434,467 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	83,821,821 - 83,830,023 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

HSBP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	68,474,960 - 68,479,206 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	68,475,948 - 68,479,145 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	68,488,788 - 68,492,964 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	68,773,360 - 68,777,530 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	68,773,360 - 68,777,489 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	68,720,849 - 68,725,018 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	68,557,358 - 68,561,548 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	68,973,475 - 68,977,644 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hsbp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	28,158,396 - 28,162,850 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	3,911,947 - 3,915,549 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	3,911,943 - 3,916,397 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HSBP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	4,788,313 - 4,798,191 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	4,795,203 - 4,798,158 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

HSBP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	69,224,715 - 69,228,607 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	6,592,908 - 6,597,926 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hsbp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	3,685,189 - 3,690,642 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	3,686,523 - 3,690,585 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hsbp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	38,993,910 - 38,998,144 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	475
Count of miRNA genes:	236
Interacting mature miRNAs:	280
Transcripts:	ENSRNOT00000019443
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

RH127949

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,405,065 - 47,405,284 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	51,989,221 - 51,989,439	NCBI	Rnor6.0
Rnor_5.0	19	62,737,761 - 62,737,979	UniSTS	Rnor5.0
RGSC_v3.4	19	49,594,295 - 49,594,513	UniSTS	RGSC3.4
Celera	19	46,664,265 - 46,664,483	UniSTS
RH 3.4 Map	19	654.0	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH124761

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,405,251 - 47,405,335 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	51,989,407 - 51,989,490	NCBI	Rnor6.0
Rnor_5.0	19	62,737,947 - 62,738,030	UniSTS	Rnor5.0
RGSC_v3.4	19	49,594,481 - 49,594,564	UniSTS	RGSC3.4
Celera	19	46,664,451 - 46,664,534	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF522937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EX491168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019443 ⟹ ENSRNOP00000019443

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,309,703 - 64,314,035 (+)	Ensembl
mRatBN7.2 Ensembl	19	47,400,966 - 47,435,821 (+)	Ensembl
Rnor_6.0 Ensembl	19	51,985,170 - 51,989,544 (+)	Ensembl

RefSeq Acc Id:

NM_173119 ⟹ NP_775142

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,309,703 - 64,314,035 (+)	NCBI
mRatBN7.2	19	47,401,039 - 47,405,373 (+)	NCBI
Rnor_6.0	19	51,985,196 - 51,989,528 (+)	NCBI
Rnor_5.0	19	62,733,736 - 62,738,068 (+)	NCBI
RGSC_v3.4	19	49,589,574 - 49,594,599 (+)	RGD
Celera	19	46,660,240 - 46,664,572 (+)	NCBI

Sequence:

show sequence

GAACTGTCGGCTTGTGGGCGTCTGCGCCAAGAAACCGAAGTCTAGGTGACGGTTCCGAGACATC
GCCGCCAAGCTGGGCACCGGAGAGATGGCCGAGACGGACCCCAAGACAATGCAGGACATCACCT
TGGTGGTGGAGACGCTCTTGCAGCAGATGCAAGACAAGTTTCAGATTATGTCGGATCAGATCAT
CGGAAGGATCGATGACATGAGCAGCCGAATCGATGACCTGGAGAAAAATATCGCTGACCTCATG
ACCCAGGCTGGAGTAGAAGAACTGGACGCTGAGAACAAGATTCCTACTGCCCAGAAGAGTTGAA
GGCTACTGGCACTTCAGACTGAGTCCAGAACATCACTTTCCCAAGCCAAGAGAAAACCAAGTGG
CTTTCTTCAACTAACTCCTATGTGTGGACAGGTTTATAAAACGTGCATTCTTATCACAGCCTGC
ATAGCCTAGAGTACCCTAGCCCCATTCCTCAAACTTGGTATCCTCACATCTTGGTCAGTTCTCT
TAATTATTAAACACTAAAATGTTGGCGGTTTCCGGATAAGATTGTCAGACTTTTTAGTGGTTTT
CTGAGGTCCTCTCCCCACTGCTCCTCTGTGGTAGTTGCTGTGTGATAAAGCGACAGAGTACTCT
TTAATTAGGTGACTGCAGCCCTTCCCCCTGGCAGGAGCCATGTGTGAAACATGAATGTTTAGCT
TTCTTTGAGTTTCAGTGCAAAGTGACTGTTGAGCCGCCACTCGAGTGTCAGAAGTTCTTCTCCA
AACGGCCGAGAACATTTCATAGTTGTCTGTGCCGAAGTGTCTATCAGAGTTTTGCATGAGATTC
TAGTAGTGTTGGTAGGACCTGCCATGCTTTCCGGCGGGATATCAGAGCCCAGTGACCCTATCCT
CCCTTCAAGCTACTGACTGAAAGGGAAGAGACCAAAAGACCCGAGTGAGCCCGCCCCCGTCAAG
TGGCTGAAAAATGCCCTTTGACCTGTGGGAGGTGCTGGTTTTTAAGAAATACTATTTTACTTGA
ACTATTTCTTGTCTAAATTCTTGCACAGTGAATTCTATTAACTAGAGAAGACAGATTTACATTC
AGAATTCTGGTGTCTGGAGGCTTGGCCTCAAGGCCACTTTTGATGACTTAGAAGACAACCTATG
TCACTGTCCCCACAAAGTGATTTCATACAATAAAGAACAAGGTAATTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_775142	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58131	(Get FASTA)	NCBI Sequence Viewer
	AAM81322	(Get FASTA)	NCBI Sequence Viewer
	EDL92660	(Get FASTA)	NCBI Sequence Viewer
	EDL92661	(Get FASTA)	NCBI Sequence Viewer
	EDL92662	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019443
GenBank Protein	Q8K3X8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_775142 ⟸ NM_173119
- UniProtKB:	Q8K3X8 (UniProtKB/Swiss-Prot), A6IZI3 (UniProtKB/TrEMBL), A0A8L2Q9S5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEEL DAENKIPTAQKS hide sequence

Ensembl Acc Id:

ENSRNOP00000019443 ⟸ ENSRNOT00000019443

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K3X8-F1-model_v2	AlphaFold	Q8K3X8	1-76	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701177

Promoter ID:

EPDNEW_R11699

Type:

initiation region

Name:

Hsbp1_1

Description:

heat shock factor binding protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	51,985,215 - 51,985,275	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628632	AgrOrtholog
BioCyc Gene	G2FUF-5522	BioCyc
Ensembl Genes	ENSRNOG00000014415	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000019443	ENTREZGENE
Gene3D-CATH	1.20.5.430	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6919748	IMAGE-MGC_LOAD
InterPro	HS1-bd	UniProtKB/Swiss-Prot
KEGG Report	rno:286899	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72658	IMAGE-MGC_LOAD
NCBI Gene	286899	ENTREZGENE
PANTHER	HEAT SHOCK FACTOR-BINDING PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR19424	UniProtKB/Swiss-Prot
Pfam	HSBP1	UniProtKB/Swiss-Prot
PhenoGen	Hsbp1	PhenoGen
RatGTEx	ENSRNOG00000014415	RatGTEx
UniProt	A0A8L2Q9S5	ENTREZGENE, UniProtKB/TrEMBL
	A6IZI2_RAT	UniProtKB/TrEMBL
	A6IZI3	ENTREZGENE, UniProtKB/TrEMBL
	HSBP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Hsbp1	heat shock factor binding protein 1			Symbol and Name status set to approved	625702	APPROVED
2003-02-27	Hsbp1	heat shock factor binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message