Advanced Search (OLGA)

Gene: Uts2r (urotensin 2 receptor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Uts2r

Name:

urotensin 2 receptor

RGD ID:

621884

Description:

Enables urotensin II receptor activity. Involved in several processes, including positive regulation of vasoconstriction; regulation of blood pressure; and regulation of circadian sleep/wake cycle. Located in early endosome and recycling endosome. Used to study acute kidney failure; endomyocardial fibrosis; and hypertension. Biomarker of cardiomyopathy and myocardial infarction. Orthologous to human UTS2R (urotensin 2 receptor); INTERACTS WITH ammonium chloride; C60 fullerene; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G-protein coupled receptor 14; G-protein coupled sensory epithelial neuropeptide-like receptor; Gpr14; putative G protein-coupled receptor (SENR); putative G protein-coupled receptor (SENR) gene; Senr; UR-2-R; UR-II-R; urotensin II receptor; urotensin-2 receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UTS2R (urotensin 2 receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Uts2r (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Uts2r (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UTS2R (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UTS2R (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Uts2r (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UTS2R (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UTS2R (urotensin 2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TANGO2 (transport and golgi organization 2 homolog)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Uts2r (urotensin 2 receptor)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	UTS2R (urotensin 2 receptor)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	uts2r	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,936,398 - 106,937,558 (+)	NCBI		GRCr8
mRatBN7.2	10	106,438,092 - 106,439,252 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	106,438,092 - 106,439,252 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	111,540,796 - 111,541,956 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	111,003,849 - 111,005,009 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	106,358,527 - 106,359,687 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	110,364,291 - 110,365,451 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	110,364,291 - 110,365,451 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,951,008 - 109,952,168 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	110,394,782 - 110,395,942 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	110,409,285 - 110,410,446 (+)	NCBI
Celera	10	104,976,678 - 104,977,838 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	acute kidney failure		IMP		2306847		RGD
Uts2r	Rat	cardiomyopathy		IEP		2306796	associated with Diabetes Mellitus more ...	RGD
Uts2r	Rat	Diabetic Nephropathies		ISO	UTS2R (Homo sapiens)	2306805	mRNA:increased expression:kidney	RGD
Uts2r	Rat	Diabetic Nephropathies		IEP		2306786	associated with Diabetes Mellitus more ...	RGD
Uts2r	Rat	endomyocardial fibrosis		IMP		2306833		RGD
Uts2r	Rat	Experimental Diabetes Mellitus		IMP		2306839		RGD
Uts2r	Rat	hypertension		IDA		1580812		RGD
Uts2r	Rat	myocardial infarction		IEP		2306846	associated with Heart Failure more ...	RGD
Uts2r	Rat	Myocardial Reperfusion Injury		IMP		2306836		RGD
Uts2r	Rat	type 2 diabetes mellitus		ISO	Uts2r (Mus musculus)	2306785	mRNA:increased expression:skeletal muscle	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	generalized epilepsy		ISO	UTS2R (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epileptic encephalopathy	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	1,2-dichloroethane	increases expression	ISO	Uts2r (Mus musculus)	6480464	ethylene dichloride results in increased expression of UTS2R mRNA	CTD	PMID:28960355
Uts2r	Rat	12-methyltetradecanoic acid	multiple interactions	ISO	UTS2R (Homo sapiens)	6480464	aseanostatin P5 binds to and results in increased activity of UTS2R protein	CTD	PMID:31378678
Uts2r	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Uts2r (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UTS2R mRNA	CTD	PMID:17942748
Uts2r	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Uts2r (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UTS2R mRNA	CTD	PMID:17942748
Uts2r	Rat	aflatoxin B1	decreases expression	ISO	UTS2R (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of UTS2R mRNA	CTD	PMID:22100608
Uts2r	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of UTS2R mRNA	CTD	PMID:16483693
Uts2r	Rat	atrazine	increases expression	ISO	UTS2R (Homo sapiens)	6480464	Atrazine results in increased expression of UTS2R mRNA	CTD	PMID:22378314
Uts2r	Rat	benzo[a]pyrene	multiple interactions	ISO	Uts2r (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to UTS2R promoter]	CTD	PMID:19654925
Uts2r	Rat	bisphenol A	decreases methylation	ISO	Uts2r (Mus musculus)	6480464	bisphenol A results in decreased methylation of UTS2R promoter	CTD	PMID:27312807
Uts2r	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of UTS2R mRNA	CTD	PMID:19167457
Uts2r	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of UTS2R mRNA	CTD	PMID:26033743
Uts2r	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of UTS2R mRNA	CTD	PMID:26033743
Uts2r	Rat	dimethyl sulfoxide	affects expression	ISO	UTS2R (Homo sapiens)	6480464	Dimethyl Sulfoxide affects the expression of UTS2R mRNA	CTD	PMID:24834073
Uts2r	Rat	disodium selenite	increases expression	ISO	UTS2R (Homo sapiens)	6480464	Sodium Selenite results in increased expression of UTS2R mRNA	CTD	PMID:18175754
Uts2r	Rat	lipopolysaccharide	multiple interactions	ISO	UTS2R (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Uts2r	Rat	N-nitrosodiethylamine	increases expression	EXP		6480464	Diethylnitrosamine results in increased expression of UTS2R mRNA and Diethylnitrosamine results in increased expression of UTS2R protein	CTD	PMID:21056072
Uts2r	Rat	paracetamol	affects expression	ISO	Uts2r (Mus musculus)	6480464	Acetaminophen affects the expression of UTS2R mRNA	CTD	PMID:17562736
Uts2r	Rat	quercitrin	increases expression	ISO	UTS2R (Homo sapiens)	6480464	quercitrin results in increased expression of UTS2R mRNA	CTD	PMID:25193878
Uts2r	Rat	resveratrol	multiple interactions	ISO	UTS2R (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of UTS2R mRNA	CTD	PMID:23557933
Uts2r	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	UTS2R (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Uts2r	Rat	S-(1,2-dichlorovinyl)-L-cysteine	decreases expression	ISO	UTS2R (Homo sapiens)	6480464	S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of UTS2R mRNA	CTD	PMID:35811015
Uts2r	Rat	silver atom	increases expression	ISO	Uts2r (Mus musculus)	6480464	Silver results in increased expression of UTS2R mRNA	CTD	PMID:27131904
Uts2r	Rat	silver(0)	increases expression	ISO	Uts2r (Mus musculus)	6480464	Silver results in increased expression of UTS2R mRNA	CTD	PMID:27131904
Uts2r	Rat	sodium arsenite	increases expression	ISO	Uts2r (Mus musculus)	6480464	sodium arsenite results in increased expression of UTS2R mRNA	CTD	PMID:37682722
Uts2r	Rat	sunitinib	decreases expression	ISO	UTS2R (Homo sapiens)	6480464	Sunitinib results in decreased expression of UTS2R mRNA	CTD	PMID:31533062
Uts2r	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of UTS2R gene	CTD	PMID:27618143
Uts2r	Rat	triclosan	decreases expression	ISO	UTS2R (Homo sapiens)	6480464	Triclosan results in decreased expression of UTS2R mRNA	CTD	PMID:30510588
Uts2r	Rat	triptonide	increases expression	ISO	Uts2r (Mus musculus)	6480464	triptonide results in increased expression of UTS2R mRNA	CTD	PMID:33045310
Uts2r	Rat	valproic acid	increases methylation	ISO	UTS2R (Homo sapiens)	6480464	Valproic Acid results in increased methylation of UTS2R gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	blood vessel diameter maintenance	involved_in	IEA	InterPro:IPR000670	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000670	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Uts2r	Rat	negative regulation of blood pressure		IMP		2306837		RGD
Uts2r	Rat	negative regulation of glomerular filtration		IMP		2306837		RGD
Uts2r	Rat	negative regulation of urine volume		IMP		2306837		RGD
Uts2r	Rat	neuropeptide signaling pathway	involved_in	IBA	FB:FBgn0036278 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Uts2r	Rat	positive regulation of angiogenesis		IMP		2306830		RGD
Uts2r	Rat	positive regulation of blood pressure		IMP		2306836		RGD
Uts2r	Rat	positive regulation of cell growth		IMP		2306846		RGD
Uts2r	Rat	positive regulation of circadian sleep/wake cycle, REM sleep		IMP		2306844		RGD
Uts2r	Rat	positive regulation of circadian sleep/wake cycle, wakefulness		IMP		2306844		RGD
Uts2r	Rat	positive regulation of cytosolic calcium ion concentration		IMP		2306846		RGD
Uts2r	Rat	positive regulation of fibroblast proliferation		IMP		2306833		RGD
Uts2r	Rat	positive regulation of vasoconstriction		IMP		2306845		RGD
Uts2r	Rat	regulation of blood pressure	involved_in	IEA	InterPro:IPR000670	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	response to xenobiotic stimulus		IEP		2306814	isoproterenol	RGD
Uts2r	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	early endosome		IDA		2306843		RGD
Uts2r	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Uts2r	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0036278 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Uts2r	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Uts2r	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Uts2r	Rat	recycling endosome		IDA		2306843		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uts2r	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Uts2r	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	urotensin II receptor activity	enables	IEA	InterPro:IPR000670	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Uts2r	Rat	urotensin II receptor activity		IDA		2306843		RGD
Uts2r	Rat	urotensin II receptor activity	enables	IBA	PANTHER:PTN001201163 and Uts2r (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Increased expression of urotensin II and its cognate receptor GPR14 in atherosclerotic lesions of the human aorta.	Bousette N, etal., Atherosclerosis. 2004 Sep;176(1):117-23.
2.	Urotensin-II receptor blockade with SB-611812 attenuates cardiac remodeling in experimental ischemic heart disease.	Bousette N, etal., Peptides. 2006 Nov;27(11):2919-26. Epub 2006 Aug 17.
3.	Pharmacology of the urotensin-II receptor antagonist palosuran (ACT-058362; 1-[2-(4-benzyl-4-hydroxy-piperidin-1-yl)-ethyl]-3-(2-methyl-quinolin-4-yl) -urea sulfate salt): first demonstration of a pathophysiological role of the urotensin System.	Clozel M, etal., J Pharmacol Exp Ther. 2004 Oct;311(1):204-12. Epub 2004 May 14.
4.	The urotensin-II receptor antagonist palosuran improves pancreatic and renal function in diabetic rats.	Clozel M, etal., J Pharmacol Exp Ther. 2006 Mar;316(3):1115-21. Epub 2005 Nov 2.
5.	Elevated expression of urotensin II and its receptor in diabetic cardiomyopathy.	Dai HY, etal., J Diabetes Complications. 2008 Mar-Apr;22(2):137-43.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Contractile responses of aortae from WKY and SHR to vasoconstrictors.	Gendron G, etal., Clin Exp Hypertens. 2004 Aug;26(6):511-23.
8.	Arrestin-independent internalization and recycling of the urotensin receptor contribute to long-lasting urotensin II-mediated vasoconstriction.	Giebing G, etal., Circ Res. 2005 Sep 30;97(7):707-15. Epub 2005 Sep 1.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Urotensin II modulates rapid eye movement sleep through activation of brainstem cholinergic neurons.	Huitron-Resendiz S, etal., J Neurosci. 2005 Jun 8;25(23):5465-74.
11.	Urotensin-II-mediated cardiomyocyte hypertrophy: effect of receptor antagonism and role of inflammatory mediators.	Johns DG, etal., Naunyn Schmiedebergs Arch Pharmacol. 2004 Oct;370(4):238-50. Epub 2004 Sep 30.
12.	Increased expression of urotensin II and urotensin II receptor in human diabetic nephropathy.	Langham RG, etal., Am J Kidney Dis. 2004 Nov;44(5):826-31.
13.	Central cardiovascular action of urotensin II in spontaneously hypertensive rats.	Lin Y, etal., Hypertens Res. 2003 Oct;26(10):839-45.
14.	Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.	Marchese A, etal., Genomics 1995 Sep 20;29(2):335-44.
15.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	Urotensin II and urotensin II-related peptide (URP) in cardiac ischemia-reperfusion injury.	Prosser HC, etal., Peptides. 2008 May;29(5):770-7. Epub 2007 Aug 21.
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Urotensin II and renal function in the rat.	Song W, etal., Kidney Int. 2006 Apr;69(8):1360-8.
21.	Urotensin-II and its receptor (UT-R) are expressed in rat brain endothelial cells, and urotensin-II via UT-R stimulates angiogenesis in vivo and in vitro.	Spinazzi R, etal., Int J Mol Med. 2006 Dec;18(6):1107-12.
22.	A novel putative neuropeptide receptor expressed in neural tissue, including sensory epithelia.	Tal M, etal., Biochem Biophys Res Commun 1995 Apr 17;209(2):752-9.
23.	Diabetes-induced upregulation of urotensin II and its receptor plays an important role in TGF-beta1-mediated renal fibrosis and dysfunction.	Tian L, etal., Am J Physiol Endocrinol Metab. 2008 Nov;295(5):E1234-42. Epub 2008 Sep 16.
24.	Elevated expression of urotensin II and its receptor in skeletal muscle of diabetic mouse.	Wang HX, etal., Regul Pept. 2009 Apr 10;154(1-3):85-90. doi: 10.1016/j.regpep.2009.01.004. Epub 2009 Jan 27.
25.	Urotensin II accelerates cardiac fibrosis and hypertrophy of rats induced by isoproterenol.	Zhang YG, etal., Acta Pharmacol Sin. 2007 Jan;28(1):36-43.

PMID:10581185	PMID:12495432	PMID:14550283	PMID:15273242	PMID:15458389	PMID:15476951	PMID:16290260	PMID:16685423	PMID:16942596	PMID:17628210	PMID:17905478	PMID:18082287
PMID:18318439	PMID:18509066	PMID:18701623	PMID:18955095	PMID:19463745	PMID:19906507	PMID:20422157	PMID:20870804	PMID:21056072	PMID:21180151	PMID:21186587	PMID:22044114
PMID:22245063	PMID:22563490	PMID:24878476	PMID:25175740	PMID:25803040	PMID:27208703	PMID:34866110

Uts2r
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,936,398 - 106,937,558 (+)	NCBI		GRCr8
mRatBN7.2	10	106,438,092 - 106,439,252 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	106,438,092 - 106,439,252 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	111,540,796 - 111,541,956 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	111,003,849 - 111,005,009 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	106,358,527 - 106,359,687 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	110,364,291 - 110,365,451 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	110,364,291 - 110,365,451 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,951,008 - 109,952,168 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	110,394,782 - 110,395,942 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	110,409,285 - 110,410,446 (+)	NCBI
Celera	10	104,976,678 - 104,977,838 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

UTS2R
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	82,371,765 - 82,377,458 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	82,371,765 - 82,377,458 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	80,329,641 - 80,335,334 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	77,925,490 - 77,926,659 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	77,925,489 - 77,926,659	NCBI
Celera	17	76,924,342 - 76,925,511 (+)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	75,730,768 - 75,731,937 (+)	NCBI		HuRef
CHM1_1	17	80,417,675 - 80,418,844 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	83,240,931 - 83,246,624 (+)	NCBI		T2T-CHM13v2.0

Uts2r
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	121,051,097 - 121,052,799 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	121,051,097 - 121,052,799 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	121,160,271 - 121,161,973 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	121,160,271 - 121,161,973 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	121,021,585 - 121,023,287 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	120,976,361 - 120,978,063 (+)	NCBI		MGSCv36	mm8
Celera	11	132,898,462 - 132,900,164 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	85.02	NCBI

Uts2r
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955506	756,859 - 761,891 (-)	NCBI	ChiLan1.0	ChiLan1.0

UTS2R
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	98,913,633 - 98,918,934 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	103,817,766 - 103,823,271 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	76,783,432 - 76,788,639 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	82,592,312 - 82,593,702 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	82,592,312 - 82,593,702 (+)	Ensembl	panpan1.1		panPan2

UTS2R
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	9	587,915 - 589,510 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	579,205 - 580,800 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	579,646 - 580,884 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	573,778 - 575,373 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	734,681 - 736,277 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	809,533 - 811,128 (-)	NCBI		UU_Cfam_GSD_1.0

Uts2r
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	541,802 - 546,097 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936923	24,952 - 31,083 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UTS2R
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	695,765 - 700,678 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	9,985 - 13,120 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UTS2R
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	74,284,472 - 74,291,074 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	74,288,333 - 74,289,502 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	45,928,730 - 45,935,411 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Uts2r
1 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	86
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000054926
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	11	21	45	30	28	19	13	19	6	78	40	39	4	32	9


RefSeq Transcripts	NM_020537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB012210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB029611	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U23483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000054926 ⟹ ENSRNOP00000051809

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	106,438,092 - 106,439,252 (+)	Ensembl
Rnor_6.0 Ensembl	10	110,364,291 - 110,365,451 (+)	Ensembl

RefSeq Acc Id:

NM_020537 ⟹ NP_065412

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,936,398 - 106,937,558 (+)	NCBI
mRatBN7.2	10	106,438,092 - 106,439,252 (+)	NCBI
Rnor_6.0	10	110,364,291 - 110,365,451 (+)	NCBI
Rnor_5.0	10	109,951,008 - 109,952,168 (+)	NCBI
RGSC_v3.4	10	110,394,782 - 110,395,942 (+)	RGD
Celera	10	104,976,678 - 104,977,838 (+)	RGD

Sequence:

show sequence

ATGGCTCTGAGCCTGGAGTCTACAACAAGCTTTCATATGCTCACCGTGTCCGGAAGCACTGTGACTGAGCTGCCTGGTGACTCCAACGTGTCCCTCAACAGTTCCTGGTCCGGCCCAACAGATCCCAG
CTCCCTGAAAGACCTTGTGGCCACGGGTGTCATCGGGGCAGTGCTCTCAGCCATGGGTGTGGTGGGCATGGTGGGAAATGTATACACTTTGGTGGTCATGTGCCGGTTTCTGCGTGCCTCGGCCTCCA
TGTACGTCTATGTGGTCAACCTAGCGCTGGCTGATCTGCTGTACCTGCTGAGCATTCCCTTCATCATAGCCACCTACGTCACTAAGGACTGGCACTTTGGAGATGTGGGCTGCAGAGTCCTCTTTAGC
CTGGACTTCCTGACAATGCACGCCAGCATCTTCACCCTGACCATAATGAGCAGCGAACGCTATGCAGCCGTACTGAGGCCTCTGGACACAGTCCAGCGCTCCAAGGGTTACCGTAAGCTGCTGGTGCT
GGGCACCTGGTTGCTGGCACTGCTGCTGACCCTACCCATGATGCTTGCCATCCAGCTGGTCCGCAGGGGCTCTAAGAGCCTCTGCCTGCCAGCCTGGGGCCCTCGTGCCCACCGTACTTACCTAACGT
TGCTCTTTGGGACCAGCATTGTGGGGCCTGGCTTGGTCATTGGGCTGCTCTATGTCCGTCTGGCCAGGGCCTACTGGCTATCTCAGCAAGCTTCTTTCAAGCAGACACGGCGGCTGCCCAACCCCAGG
GTGCTCTACCTCATCCTTGGTATCGTCCTTCTCTTCTGGGCCTGCTTTCTACCCTTCTGGCTGTGGCAGCTGCTGGCCCAGTACCACGAGGCCATGCCACTGACTCCCGAGACTGCACGCATTGTCAA
CTACCTGACCACCTGCCTCACTTATGGCAACAGTTGCATCAATCCCTTCCTCTACACTCTGCTCACCAAGAACTATCGAGAGTACCTACGTGGCCGCCAGCGGTCACTGGGTAGTAGTTGCCACAGCC
CAGGGAGTCCTGGCAGCTTCCTGCCCAGCCGAGTCCACCTCCAGCAGGACTCGGGCCGCTCGCTGTCCTCCAGCAGCCAACAGGCCACAGAGACCCTCATGCTGTCTCCAGTCCCCCGTAACGGGGCC
CTTCTCTGA

hide sequence


Protein RefSeqs	NP_065412	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA80111	(Get FASTA)	NCBI Sequence Viewer
	AAC52593	(Get FASTA)	NCBI Sequence Viewer
	BAA25251	(Get FASTA)	NCBI Sequence Viewer
	BAA82357	(Get FASTA)	NCBI Sequence Viewer
	EDM06933	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051809
	ENSRNOP00000051809.1
GenBank Protein	P49684	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_065412 ⟸ NM_020537

- UniProtKB:

P48041 (UniProtKB/Swiss-Prot), P49684 (UniProtKB/Swiss-Prot), A6HLM8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALSLESTTSFHMLTVSGSTVTELPGDSNVSLNSSWSGPTDPSSLKDLVATGVIGAVLSAMGVVGMVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIIATYVTKDWHFGDVGCRVLFS
LDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLVLGTWLLALLLTLPMMLAIQLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYVRLARAYWLSQQASFKQTRRLPNPR
VLYLILGIVLLFWACFLPFWLWQLLAQYHEAMPLTPETARIVNYLTTCLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCHSPGSPGSFLPSRVHLQQDSGRSLSSSSQQATETLMLSPVPRNGA
LL

hide sequence

Ensembl Acc Id:

ENSRNOP00000051809 ⟸ ENSRNOT00000054926

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P49684-F1-model_v2	AlphaFold	P49684	1-386	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22366	BioCyc
Ensembl Genes	ENSRNOG00000036669	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000054926	ENTREZGENE
	ENSRNOT00000054926.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Urot_II_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:57305	UniProtKB/Swiss-Prot
NCBI Gene	57305	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	UROTENSIN-2 RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Uts2r	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	UROTENSIN2R	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000036669	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6HLM8	ENTREZGENE, UniProtKB/TrEMBL
	P48041	ENTREZGENE
	P49684	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P48041	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Uts2r	urotensin 2 receptor	Senr	putative G protein-coupled receptor (SENR) gene	Symbol and Name updated	1299863	APPROVED
2002-08-07	Senr	putative G protein-coupled receptor (SENR) gene			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_homology	shows 27% overall identity and 41% in the transmembrane domains to the somatostatin receptor SSTR 4	633970

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar