Advanced Search (OLGA)

Gene: Necab2 (N-terminal EF-hand calcium binding protein 2) Rattus norvegicus

Analyze

Symbol:

Necab2

Name:

N-terminal EF-hand calcium binding protein 2

RGD ID:

621844

Description:

Predicted to enable A2A adenosine receptor binding activity; identical protein binding activity; and type 5 metabotropic glutamate receptor binding activity. Predicted to be involved in positive regulation of protein localization to membrane; regulation of amyloid precursor protein biosynthetic process; and regulation of signal transduction. Is active in postsynapse and presynapse. Orthologous to human NECAB2 (N-terminal EF-hand calcium binding protein 2); INTERACTS WITH 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

EF hand calcium binding protein 2; Efcbp2; N-terminal EF-hand calcium-binding protein 2; neuronal calcium binding 2; neuronal calcium-binding protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,409,627 - 64,436,371 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,409,751 - 64,436,369 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,501,351 - 47,527,722 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,501,302 - 47,527,684 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,295,727 - 54,322,102 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,976,533 - 55,002,936 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,189,946 - 57,216,301 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,086,325 - 52,112,633 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,086,325 - 52,112,629 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,834,865 - 62,861,130 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,691,466 - 49,718,718 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,743,032 - 46,786,775 (+)	NCBI		Celera
RGSC_v3.1	19	49,696,347 - 49,723,599 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (EXP)

acrylamide (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cocaine (EXP)

diarsenic trioxide (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethylparaben (ISO)

flavonoids (EXP)

folic acid (ISO)

GW 4064 (ISO)

ochratoxin A (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

propanal (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-mediated signaling (NAS)

negative regulation of G protein-coupled receptor internalization (IEA,ISO)

positive regulation of adenosine receptor signaling pathway (IEA,ISO)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of glutamate receptor signaling pathway (IEA,ISO)

positive regulation of protein localization to membrane (IEA,ISO)

regulation of amyloid precursor protein biosynthetic process (IBA)

Cellular Component

axon (IEA)

cytoplasm (IBA,IEA)

dendrite (IEA)

plasma membrane (IEA,ISO)

postsynapse (IDA)

presynapse (IDA)

Molecular Function

A2A adenosine receptor binding (IEA,ISO)

calcium ion binding (IEA)

identical protein binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

type 5 metabotropic glutamate receptor binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The neuronal Ca(2+) -binding protein 2 (NECAB2) interacts with the adenosine A(2A) receptor and modulates the cell surface expression and function of the receptor.	Canela L, etal., Mol Cell Neurosci. 2007 Sep;36(1):1-12. doi: 10.1016/j.mcn.2007.05.007. Epub 2007 Jun 27.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.	Sugita S, etal., Neuroscience 2002;112(1):51-63.

Additional References at PubMed

PMID:19694902	PMID:25416956	PMID:27107012	PMID:28131823	PMID:32557241

Genomics

Comparative Map Data

Necab2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,409,627 - 64,436,371 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,409,751 - 64,436,369 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,501,351 - 47,527,722 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,501,302 - 47,527,684 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,295,727 - 54,322,102 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,976,533 - 55,002,936 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,189,946 - 57,216,301 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,086,325 - 52,112,633 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,086,325 - 52,112,629 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,834,865 - 62,861,130 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,691,466 - 49,718,718 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,743,032 - 46,786,775 (+)	NCBI		Celera
RGSC_v3.1	19	49,696,347 - 49,723,599 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

NECAB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	83,965,177 - 84,002,776 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	83,968,244 - 84,002,776 (+)	Ensembl			hg38	GRCh38
GRCh37	16	84,001,849 - 84,036,381 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	82,559,738 - 82,593,880 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	82,559,737 - 82,593,878	NCBI
Celera	16	68,304,639 - 68,338,784 (+)	NCBI		Celera
Cytogenetic Map	16	q23.3	NCBI
HuRef	16	69,754,045 - 69,790,327 (+)	NCBI		HuRef
CHM1_1	16	85,413,645 - 85,447,739 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	90,031,233 - 90,068,832 (+)	NCBI		T2T-CHM13v2.0

Necab2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	120,173,431 - 120,199,379 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	120,173,458 - 120,199,379 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	119,446,719 - 119,472,640 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	119,446,719 - 119,472,640 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	121,970,619 - 121,996,535 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	122,332,696 - 122,358,612 (+)	NCBI		MGSCv36	mm8
Celera	8	123,664,580 - 123,689,964 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	67.73	NCBI

Necab2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955564	258,222 - 277,889 (-)	Ensembl
ChiLan1.0	NW_004955564	257,781 - 279,937 (-)	NCBI	ChiLan1.0	ChiLan1.0

NECAB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	93,716,998 - 93,750,851 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	99,633,754 - 99,668,065 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	64,636,198 - 64,670,019 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	83,979,108 - 84,013,436 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	83,983,626 - 84,013,436 (+)	Ensembl			panPan2	panpan1.1

NECAB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	68,313,699 - 68,342,253 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	68,314,000 - 68,378,311 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	68,327,774 - 68,357,105 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	68,612,120 - 68,641,500 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	68,612,421 - 68,641,500 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	68,559,839 - 68,589,193 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	68,396,250 - 68,425,583 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	68,812,005 - 68,841,393 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Necab2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	28,025,477 - 28,046,190 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	3,779,374 - 3,799,581 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	3,779,024 - 3,802,883 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NECAB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	4,598,752 - 4,641,450 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NECAB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	69,380,328 - 69,413,985 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	6,360,688 - 6,394,401 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Necab2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	3,552,719 - 3,577,433 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	3,552,719 - 3,574,124 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Necab2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	39,093,781 - 39,119,653 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	290
Count of miRNA genes:	179
Interacting mature miRNAs:	201
Transcripts:	ENSRNOT00000020341
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

D3Rat22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,483,643 - 47,483,996 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,068,621 - 52,068,973	NCBI	Rnor6.0
Rnor_5.0	19	62,817,161 - 62,817,513	UniSTS	Rnor5.0
RGSC_v3.4	19	49,673,571 - 49,674,008	RGD	RGSC3.4
RGSC_v3.4	19	49,673,609 - 49,673,961	UniSTS	RGSC3.4
Celera	19	46,742,921 - 46,743,273	UniSTS
RGSC_v3.1	19	49,678,490 - 49,678,842	RGD
RH 3.4 Map	19	650.9	RGD
RH 3.4 Map	19	650.9	UniSTS
RH 2.0 Map	19	676.2	RGD
FHH x ACI Map	3	60.54	RGD
Cytogenetic Map	19	q12	UniSTS

AU047953

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	64,400,269 - 64,400,403 (+)	Marker Load Pipeline
mRatBN7.2	19	47,491,621 - 47,491,755 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,076,596 - 52,076,729	NCBI	Rnor6.0
Rnor_5.0	19	62,825,136 - 62,825,269	UniSTS	Rnor5.0
RGSC_v3.4	19	49,681,584 - 49,681,717	UniSTS	RGSC3.4
Celera	19	46,750,896 - 46,751,029	UniSTS
Cytogenetic Map	19	q12	UniSTS

AI236754

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,500,358 - 47,500,491 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,085,333 - 52,085,465	NCBI	Rnor6.0
Rnor_5.0	19	62,833,873 - 62,834,005	UniSTS	Rnor5.0
RGSC_v3.4	19	49,690,321 - 49,690,453	UniSTS	RGSC3.4
Celera	19	46,759,633 - 46,759,765	UniSTS
RH 3.4 Map	19	648.6	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH130737

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,527,291 - 47,527,471 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,112,203 - 52,112,382	NCBI	Rnor6.0
Rnor_5.0	19	62,860,697 - 62,860,876	UniSTS	Rnor5.0
Celera	19	46,786,345 - 46,786,524	UniSTS
RH 3.4 Map	19	653.0	UniSTS
Cytogenetic Map	19	q12	UniSTS

BF387455

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,515,254 - 47,515,408 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,100,227 - 52,100,380	NCBI	Rnor6.0
Rnor_5.0	19	62,848,767 - 62,848,920	UniSTS	Rnor5.0
RGSC_v3.4	19	49,706,267 - 49,706,420	UniSTS	RGSC3.4
RGSC_v3.4	19	49,705,325 - 49,705,478	UniSTS	RGSC3.4
Celera	19	46,774,307 - 46,774,460	UniSTS
RH 3.4 Map	19	636.1	UniSTS
Cytogenetic Map	19	q12	UniSTS

BF402232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,522,920 - 47,524,135 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,107,832 - 52,109,046	NCBI	Rnor6.0
Rnor_5.0	19	62,856,326 - 62,857,540	UniSTS	Rnor5.0
RGSC_v3.4	19	49,714,332 - 49,715,546	UniSTS	RGSC3.4
Celera	19	46,781,974 - 46,783,188	UniSTS
RH 3.4 Map	19	653.0	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	10	62	154	91	90	59	62	59	6	309	153	6	136	77	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF193757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020341 ⟹ ENSRNOP00000020341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,409,944 - 64,436,369 (+)	Ensembl
mRatBN7.2 Ensembl	19	47,501,302 - 47,527,684 (+)	Ensembl
Rnor_6.0 Ensembl	19	52,086,325 - 52,112,629 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106560 ⟹ ENSRNOP00000076965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,409,950 - 64,436,369 (+)	Ensembl
mRatBN7.2 Ensembl	19	47,501,302 - 47,527,684 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148837 ⟹ ENSRNOP00000100370

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,409,751 - 64,436,368 (+)	Ensembl

RefSeq Acc Id:

NM_133415 ⟹ NP_596906

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,409,999 - 64,436,368 (+)	NCBI
mRatBN7.2	19	47,501,351 - 47,527,722 (+)	NCBI
Rnor_6.0	19	52,086,325 - 52,112,633 (+)	NCBI
Rnor_5.0	19	62,834,865 - 62,861,130 (+)	NCBI
RGSC_v3.4	19	49,691,466 - 49,718,718 (+)	RGD
Celera	19	46,743,032 - 46,786,775 (+)	RGD

Sequence:

show sequence

GGAATTCCGGGAGCCGCCGCCGCAGGGTCGCGCGCTGGGCGGGCTGCTGCGCTGGGTGGGCGCC
AGGATGGGGGAACCCCGCGCACCGCTCGTCCCCGACATCCCCGCCGCGGACCCCGACCCCGGGC
CCGCCGCACCGCGAGGGGGCACAGCCGTCATCCTGGACATTTTCCGCCGTGCGGATAAAAACGA
CGACGGGAAACTGTCCCTTGAGGAATTTCAACTGTTCTTCGCGGATGGCGTCCTCAATGAGAAG
GAGCTGGAGGGCCTCTTCCACACCATTGATTCAGACAACACCAACCATGTGGACACAAAGGAAT
TGTGTGATTACTTTGTGGAACACATGGGAGACTACGAAGATGTCCTGGCCTCCCTCGAGACTTT
GAACCACTCAGTCCTGAAGGCTATGGGCTACACCAAGAAGGTGTATGAAGGTGGGAACAACGTG
GACCAGTTTGTGACCCGCTTCCTTCTGAAGGAGACGGCCAATCAGATCCAGTCGCTGCTCAGCT
CTGTGGAAAGCGCCGTGGAAGCCATCGAAGAACAGACCAGCCAGATCCGACAGGACTACTGCAA
ACCTAGTCATGGCGTCAACGAGAGCCGCTACGGAGGACCCACTCCTCCCTACATCCCCAACCAC
AAGCTTGTGGTCCCGGAACCAGTGAAGAGCCTGCCTGTGGCCATAGGGGAGCCAAAGGAGGAGG
GGCTGGAGGTCCAGATAAGCCGGTTGGCAGAGCTGATTGGGAGACTGGAGAGCAAGACCCTCTC
GTTTGACCTGCAGCAGCGCCTCTCGGATGAAGAAGGCACCAACATGTACCTGCAGCTGGTCCGG
CAGGAGATGGCCGTGTGCCCTGAGCAGCTGGGCGAGTTCTTGGATTCCCTGAGACAGTACCTTC
GGAGCACTGCTGAAGAAAAGAACTGCTTCCATGTGGCCGCGGTGAGGATGGCAGATGGGCTAAC
CTTCGTCATCTACGAGTTCTGGGAGACAGAGGAGGAGTGGAAGAAGCACCTGCAGAGCCCTGTG
TGCAAGGGCTTCCGACATGTCAAGGTTGACACACTGAGCCAGCCTGAGGCACTCTCCCAGATCT
CCGTGCCAGCTGCCTGGTGCACCTCCGGCCGAGACTGACCCCTCCCAGTTAAGAAGTCCTACTG
CTAGTCCCATGACCCTTCTTGTAAAGGCCAATACCCTTTTCTAGATACTTTGGTAAACAGCTGT
CTTTTCAATATACGTATATATCAAAGGACTTGTATTTCCCCTGCTGTGGCACAGAGGAAGCCCA
TCCCCTGGCGTCCCCACACCTGACTCCACCTGGCAGACTACTCTTGCAACGATCCTGGCACGCT
AGTAGGGGTGGCTTCCCCACCCCAGCCAGCTTCTGGCATCCCTGATTCTTAATAGCTGAGGCCC
AGCAGGGCCCACCTCAGGTGGACAGGCCTGCTCCTCTACATCTGTCCTCTTTGATGGCCCTCTA
CCTAGTAGAGCTATGACCCTGTAGGTACCCAATCTAGGCTTGGGTAGAGCCCAGGGTCCCCAGC
ACCCACACTAGGGCCCACAGCNCACCCAAATAAAGTCTGGTTAGGAACAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063277745 ⟹ XP_063133815

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,410,166 - 64,436,371 (+)	NCBI

RefSeq Acc Id:

XM_063277746 ⟹ XP_063133816

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,410,166 - 64,434,464 (+)	NCBI

RefSeq Acc Id:

XM_063277747 ⟹ XP_063133817

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,409,627 - 64,436,371 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_596906	(Get FASTA)	NCBI Sequence Viewer
	XP_063133815	(Get FASTA)	NCBI Sequence Viewer
	XP_063133816	(Get FASTA)	NCBI Sequence Viewer
	XP_063133817	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG28413	(Get FASTA)	NCBI Sequence Viewer
	EDL92668	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020341.7
	ENSRNOP00000100370
GenBank Protein	F1LQY6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_596906 ⟸ NM_133415

- UniProtKB:

Q9ESB4 (UniProtKB/Swiss-Prot), F1LQY6 (UniProtKB/Swiss-Prot), A0A5H1ZRU5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEPRAPLVPDIPAADPDPGPAAPRGGTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKE
LEGLFHTIDSDNTNHVDTKELCDYFVEHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGNNVD
QFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQIRQDYCKPSHGVNESRYGGPTPPYIPNHK
LVVPEPVKSLPVAIGEPKEEGLEVQISRLAELIGRLESKTLSFDLQQRLSDEEGTNMYLQLVRQ
EMAVCPEQLGEFLDSLRQYLRSTAEEKNCFHVAAVRMADGLTFVIYEFWETEEEWKKHLQSPVC
KGFRHVKVDTLSQPEALSQISVPAAWCTSGRD

hide sequence

Ensembl Acc Id:

ENSRNOP00000020341 ⟸ ENSRNOT00000020341

Ensembl Acc Id:

ENSRNOP00000076965 ⟸ ENSRNOT00000106560

RefSeq Acc Id:	XP_063133817 ⟸ XM_063277747
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063133815 ⟸ XM_063277745
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063133816 ⟸ XM_063277746
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000100370 ⟸ ENSRNOT00000148837

Protein Domains

ABM EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LQY6-F1-model_v2	AlphaFold	F1LQY6	1-389	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701180

Promoter ID:

EPDNEW_R11702

Type:

single initiation site

Name:

Necab2_1

Description:

N-terminal EF-hand calcium binding protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	52,086,320 - 52,086,380	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621844	AgrOrtholog
BioCyc Gene	G2FUF-5517	BioCyc
Ensembl Genes	ENSRNOG00000015084	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020341.8	UniProtKB/Swiss-Prot
	ENSRNOT00000148837	ENTREZGENE
Gene3D-CATH	3.30.70.100	UniProtKB/Swiss-Prot
	EF-hand	UniProtKB/Swiss-Prot
InterPro	ABM_dom	UniProtKB/Swiss-Prot
	Dimeric_a/b-barrel	UniProtKB/Swiss-Prot
	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
	NECAB1/2/3	UniProtKB/Swiss-Prot
KEGG Report	rno:170928	UniProtKB/Swiss-Prot
NCBI Gene	170928	ENTREZGENE
PANTHER	N-TERMINAL EF-HAND CALCIUM-BINDING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR12178	UniProtKB/Swiss-Prot
Pfam	ABM	UniProtKB/Swiss-Prot
	EF-hand_7	UniProtKB/Swiss-Prot
PhenoGen	Necab2	PhenoGen
PROSITE	ABM	UniProtKB/Swiss-Prot
	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015084	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
	SSF54909	UniProtKB/Swiss-Prot
UniProt	A0A5H1ZRU5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5YBK3_RAT	UniProtKB/TrEMBL
	F1LQY6	ENTREZGENE, UniProtKB/Swiss-Prot
	Q9ESB4	ENTREZGENE
UniProt Secondary	Q9ESB4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-25	Necab2	N-terminal EF-hand calcium binding protein 2	Efcbp2	EF hand calcium binding protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Efcbp2	EF hand calcium binding protein 2		neuronal calcium binding 2	Name updated	1299863	APPROVED
2004-09-10	Efcbp2	neuronal calcium binding 2	Necab2		Symbol and Name updated	1299863	APPROVED
2002-08-07	Necab2	neuronal calcium binding 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a single N-terminal EF-hand domain	633497
gene_expression	expressed in brain	633497
gene_product	member of a family of neuronal Ca2+ binding proteins	633497

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message