Advanced Search (OLGA)

Gene: Ddx52 (DExD-box helicase 52) Rattus norvegicus

Analyze

Symbol:

Ddx52 (Ensembl: AC105531.1)

Name:

DExD-box helicase 52 (Ensembl:synergin, gamma)

RGD ID:

621743

Description:

Predicted to enable RNA helicase activity. Predicted to be involved in maturation of SSU-rRNA. Predicted to be located in nucleolus. Orthologous to human DDX52 (DExD-box helicase 52); INTERACTS WITH 2,4-dinitrotoluene; 3-chloropropane-1,2-diol; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP-dependent RNA helicase ROK1-like; ATP-dependent, RNA helicase; DEAD (Asp-Glu-Ala-Asp) box polypeptide 52; DEAD box protein 52; DEAD-box helicase 52; probable ATP-dependent RNA helicase DDX52; Rok1; rROK1L

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX52 (DExD-box helicase 52)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):	Ddx52 (DExD box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ddx52 (DExD-box helicase 52)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IQCB1 (IQ motif containing B1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DDX52 (DExD-box helicase 52)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx52 (DExD box helicase 52)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx52 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 52)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5589	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ROK1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ddx-52	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx52	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx52	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Bp299

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	69,322,062 - 69,344,856 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	69,322,114 - 69,428,714 (+)	Ensembl				GRCr8
mRatBN7.2	10	68,824,594 - 68,847,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,824,645 - 68,848,266 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	73,444,647 - 73,467,375 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,949,656 - 72,972,384 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	68,414,078 - 68,436,804 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	71,253,667 - 71,276,397 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	71,253,598 - 71,277,277 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	70,864,522 - 70,888,590 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	72,222,689 - 72,245,419 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	67,754,185 - 67,776,912 (+)	NCBI		Celera
RGSC_v3.1	10	72,237,058 - 72,259,788 (+)	NCBI
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

deoxynivalenol (ISO)

dioxygen (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

fipronil (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

lead(0) (ISO)

linsidomine (EXP)

methamphetamine (EXP)

methidathion (ISO)

methyl methanesulfonate (ISO)

paracetamol (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endocytosis (IEA)

maturation of SSU-rRNA (IBA,IEA)

protein transport (IEA)

rRNA processing (TAS)

Cellular Component

clathrin coat of trans-Golgi network vesicle (IEA)

clathrin-coated vesicle (IEA)

cytoplasmic vesicle (IEA)

Golgi apparatus (IEA)

nucleolus (IEA,ISO)

perinuclear region of cytoplasm (IEA)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

helicase activity (IEA)

hydrolase activity (IEA)

nucleic acid binding (IEA)

nucleotide binding (IEA)

RNA binding (IEA)

RNA helicase activity (IEA,NAS)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

increased systemic arterial blood pressure (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Group II phospholipase A2 inhibitors suppressed lysophosphatidylserine-dependent degranulation of rat peritoneal mast cells.	Murakami M, etal., Biochem Biophys Res Commun. 1991 Dec 16;181(2):714-21.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Fine-mapping and comprehensive transcript analysis reveals nonsynonymous variants within a novel 1.17 Mb blood pressure QTL region on rat chromosome 10.	Saad Y, etal., Genomics. 2007 Jan 9;.
10.	Rok1p is a putative RNA helicase required for rRNA processing.	Venema J, etal., Mol Cell Biol 1997 Jun;17(6):3398-407.

Additional References at PubMed

PMID:12477932	PMID:19946888	PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Ddx52
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	69,322,062 - 69,344,856 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	69,322,114 - 69,428,714 (+)	Ensembl				GRCr8
mRatBN7.2	10	68,824,594 - 68,847,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,824,645 - 68,848,266 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	73,444,647 - 73,467,375 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,949,656 - 72,972,384 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	68,414,078 - 68,436,804 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	71,253,667 - 71,276,397 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	71,253,598 - 71,277,277 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	70,864,522 - 70,888,590 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	72,222,689 - 72,245,419 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	67,754,185 - 67,776,912 (+)	NCBI		Celera
RGSC_v3.1	10	72,237,058 - 72,259,788 (+)	NCBI
Cytogenetic Map	10	q26	NCBI

DDX52
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	37,609,739 - 37,643,446 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	37,609,739 - 37,643,446 (-)	Ensembl			hg38	GRCh38
GRCh37	17	35,969,787 - 36,003,475 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	33,046,526 - 33,077,600 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	33,046,525 - 33,077,600	NCBI
Celera	17	32,795,453 - 32,826,538 (-)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	31,909,783 - 31,940,869 (-)	NCBI		HuRef
CHM1_1	17	36,003,881 - 36,035,027 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	38,596,713 - 38,630,405 (-)	NCBI		T2T-CHM13v2.0

Ddx52
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	83,831,659 - 83,853,914 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	83,832,888 - 83,853,914 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	83,942,090 - 83,963,088 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	83,942,062 - 83,963,088 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	83,755,592 - 83,776,590 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	83,758,373 - 83,778,385 (+)	NCBI		MGSCv36	mm8
Celera	11	93,547,131 - 93,568,131 (+)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	51.24	NCBI

Ddx52
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	409,249 - 438,951 (+)	Ensembl
ChiLan1.0	NW_004955451	409,827 - 437,757 (+)	NCBI	ChiLan1.0	ChiLan1.0

DDX52
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	27,110,284 - 27,140,265 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	28,993,807 - 29,023,696 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	19,433,036 - 19,466,975 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	19,734,568 - 19,764,235 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	19,734,588 - 19,763,689 (+)	Ensembl			panPan2	panpan1.1

DDX52
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	37,368,243 - 37,390,526 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	36,591,966 - 36,614,581 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	38,178,409 - 38,201,242 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	38,178,113 - 38,201,194 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	36,959,168 - 36,982,024 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	37,246,741 - 37,269,434 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	37,333,761 - 37,356,661 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ddx52
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	36,315,998 - 36,323,696 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	743,482 - 760,712 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	743,482 - 758,886 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX52
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	39,072,314 - 39,143,685 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	39,072,310 - 39,095,558 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	40,713,951 - 40,739,656 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX52
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	30,138,075 - 30,168,803 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	30,138,084 - 30,170,332 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	861,831 - 892,190 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx52
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624871	4,596,313 - 4,622,634 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ddx52
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	86,715,748 - 86,738,534 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ddx52
102 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	229
Count of miRNA genes:	149
Interacting mature miRNAs:	170
Transcripts:	ENSRNOT00000003600
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	67439473	73950209	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	67476608	73695498	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	67476608	73695498	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	64139597	83061459	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Got161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	68,835,063 - 68,835,282 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,264,073 - 71,264,291	NCBI	Rnor6.0
Rnor_5.0	10	70,875,386 - 70,875,604	UniSTS	Rnor5.0
RGSC_v3.4	10	72,233,094 - 72,233,313	RGD	RGSC3.4
RGSC_v3.4	10	72,233,095 - 72,233,313	UniSTS	RGSC3.4
Celera	10	67,764,593 - 67,764,811	UniSTS
RGSC_v3.1	10	72,247,464 - 72,247,683	RGD
Cytogenetic Map	10	q26	UniSTS

D10Chm122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	68,832,099 - 68,832,295 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,261,109 - 71,261,304	NCBI	Rnor6.0
Rnor_5.0	10	70,872,422 - 70,872,617	UniSTS	Rnor5.0
RGSC_v3.4	10	72,230,131 - 72,230,326	UniSTS	RGSC3.4
Celera	10	67,761,629 - 67,761,824	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH130612

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	68,847,047 - 68,847,230 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,276,056 - 71,276,238	NCBI	Rnor6.0
Rnor_5.0	10	70,887,369 - 70,887,551	UniSTS	Rnor5.0
RGSC_v3.4	10	72,245,078 - 72,245,260	UniSTS	RGSC3.4
Celera	10	67,776,571 - 67,776,753	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH137619

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	68,839,524 - 68,839,756 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,268,534 - 71,268,765	NCBI	Rnor6.0
Rnor_5.0	10	70,879,847 - 70,880,078	UniSTS	Rnor5.0
RGSC_v3.4	10	72,237,556 - 72,237,787	UniSTS	RGSC3.4
Celera	10	67,769,054 - 67,769,285	UniSTS
Cytogenetic Map	10	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB055628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC105531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF121975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF121976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003600 ⟹ ENSRNOP00000003600

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	68,824,645 - 68,848,266 (+)	Ensembl
Rnor_6.0 Ensembl	10	71,253,598 - 71,277,277 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119012 ⟹ ENSRNOP00000083648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	68,824,645 - 68,848,266 (+)	Ensembl

RefSeq Acc Id:

NM_053525 ⟹ NP_445977

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	69,322,126 - 69,344,856 (+)	NCBI
mRatBN7.2	10	68,824,658 - 68,847,389 (+)	NCBI
Rnor_6.0	10	71,253,667 - 71,276,397 (+)	NCBI
Rnor_5.0	10	70,864,522 - 70,888,590 (+)	NCBI
RGSC_v3.4	10	72,222,689 - 72,245,419 (+)	RGD
Celera	10	67,754,185 - 67,776,912 (+)	RGD

Sequence:

show sequence

GTAAAGATGGATTCCTACGATCTGTTTCGCCGGCTCGGAGCCGGCGCCAAGTTCGACGTGAAGC
GGTTCTCAGCAGACGCTACTCGATTCCAGGTAGGAAAAAGAAAATTCGGTTCTGATTCTTCAGA
GACCGTGAAGGGACTAGACTTCTTCGGAAACAAGAAATCTGTCTCAGATGAGTGTGGAGGATTA
CAAACACAGCAGGAGCTCCAAAATGAGGAGACAACAGAAGGGGGCCTGCTGGAAAGGAGTAAGG
AGCCGAAGAAGAAAAAGAGAAAGAAGATGACTGCAGACGTTCCTGCTCAAGAAGACCTTGACGG
GACGATACAGTGGACATCCTCTGTGGAAGCAAAGCTTCAAGATAAAAAAGCCAATGGAGAGAAG
AAATTAACTTCAGAAAAGTTGGAGCATCTCAGAAAGGAAAAGATCAACTTCTTTCGGAACAAAC
ACAAGATACATGTCCAAGGAACTGATCTTCCTGACCCAATTGCTACATTTCAGCAACTTGATCA
AGAATATAAGATCAGTCCTCGATTGCTCCAGAATATTCTAGATGCAGGCTTCCAGGTGCCCACA
CCAATTCAGATGCAAGCCATTCCAGTTATGCTGCATGGTCGGGAACTTCTGGCTTCTGCTCCTA
CTGGATCCGGGAAGACGTTGGCATTTAGCATCCCCATTTTAATGCAGCTGAAACAACCCACAAA
TAAAGGCTTTAGAGCCCTGGTTATATCCCCAACCCGAGAACTTGCCAGCCAGATTCACAGAGAA
TTAATTAAAATATCTGAGGGTACAGGATTCAGGATACATATGATCCACAAAGCTGCAATAGCAG
CTAAGAAATTTGGACCTAAATCATCTAAGAAGTTTGATATCCTTGTGACCACTCCAAATCGACT
GATCTACTTGCTGAAGCAGGAGCCGCCAGGGATAGACCTAACAAGTGTTGAGTGGCTGGTAGTA
GATGAGTCGGACAAACTGTTCGAAGATGGCAAAACTGGGTTTCGAGACCAGCTGGCTTCCATTT
TCCTGGCCTGCACATCCCCCAAGGTCAGAAGAGCAATGTTCAGTGCAACTTTCGCATATGACGT
TGAGCAGTGGTGCAAGCTCAACCTGGATAACATAGTTTCCGTATCCATTGGAGCAAGGAATTCT
GCAGTTGAAACTGTTGAACAAGAGCTTCTGTTTGTTGGATCGGAGACTGGAAAACTTCTGGCCA
TGAGAGAACTTGTTAAAAAAGGCTTCAATCCACCTGTCCTTGTTTTTGTTCAGTCCATTGAAAG
GGCTAAAGAGCTTTTCCATGAGCTCATATATGAAGGTATTAATGTGGACGTCATTCATGCAGAA
AGAACACAGCAGCAGAGAGATAACACAGTCCACAGCTTCAGAGCAGGAAAAATCTGGGTTCTTA
TTTGTACAGCCTTGCTTGCAAGAGGGATTGACTTTAAAGGTGTAAACCTGGTCATCAATTATGA
TTTCCCAACCAGCTCAGTGGAATACATCCATAGGATAGGTCGAACTGGAAGAGCAGGGAATAGG
GGAAAGGCTGTTACATTTTTCACCGAAGATGATAAACCATTACTAAGAAGTGTTGCCAATGTTA
TTCAGCAGGCTGGTTGTCCTGTACCTGAATACATCAAAGGTTTCCAGAAACTACTGAGCAAACA
AAAGAAAAAAATGATTAAGAAGCCATTGGAAAGGGAGAGCATTAGTACAACTCCAAAATATTTC
TTAGAGCAAGCTAAACAGAAAAAGGTTGCTGGCCAAAACAGCAAGAAGAAAGAAACTCTTAAAG
GAAAAAGTTAAAAATAAACACCCTGCAGTGCAATTTATGAACTCGGCATGAATTCTCATGGAGT
ACCTACAACTATCTTTACCAAACATTTTAAGTCAACAAGGGTATGAGAGAACAAAATGGTCCTG
ATTTAGTGACTTGTCAAGCTTCACTTTGTAAATGGGATTTATACAATGGAAATAACATGCATTG
ACATTTCTGCCTGAATCTAGAGAGCTACTTCTTATAGAAGAACAAAGCTGATGCTAAAATAACA
CCCATGTGGTGAACTCTTAAGGATTTTGCCCTTCAAGTGTGAAGGAAAGTGTGATGCATGCTGT
GGAGAGGCATCTGGAACAGAATTTTAAAATAAAACCTTGAGCTCGCAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039086999 ⟹ XP_038942927

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	69,322,062 - 69,344,856 (+)	NCBI
mRatBN7.2	10	68,824,594 - 68,847,400 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_445977	(Get FASTA)	NCBI Sequence Viewer
	XP_038942927	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89107	(Get FASTA)	NCBI Sequence Viewer
	ABL63414	(Get FASTA)	NCBI Sequence Viewer
	ABL63415	(Get FASTA)	NCBI Sequence Viewer
	BAB32441	(Get FASTA)	NCBI Sequence Viewer
	EDM05501	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003600
	ENSRNOP00000003600.3
	ENSRNOP00000083648
GenBank Protein	Q99PT0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445977 ⟸ NM_053525

- UniProtKB:

Q99PT0 (UniProtKB/Swiss-Prot), A6HHJ6 (UniProtKB/TrEMBL), A1EC69 (UniProtKB/TrEMBL), Q5FWY7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSYDLFRRLGAGAKFDVKRFSADATRFQVGKRKFGSDSSETVKGLDFFGNKKSVSDECGGLQT
QQELQNEETTEGGLLERSKEPKKKKRKKMTADVPAQEDLDGTIQWTSSVEAKLQDKKANGEKKL
TSEKLEHLRKEKINFFRNKHKIHVQGTDLPDPIATFQQLDQEYKISPRLLQNILDAGFQVPTPI
QMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPTNKGFRALVISPTRELASQIHRELI
KISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQEPPGIDLTSVEWLVVDE
SDKLFEDGKTGFRDQLASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDNIVSVSIGARNSAV
ETVEQELLFVGSETGKLLAMRELVKKGFNPPVLVFVQSIERAKELFHELIYEGINVDVIHAERT
QQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGK
AVTFFTEDDKPLLRSVANVIQQAGCPVPEYIKGFQKLLSKQKKKMIKKPLERESISTTPKYFLE
QAKQKKVAGQNSKKKETLKGKS

hide sequence

Ensembl Acc Id:

ENSRNOP00000003600 ⟸ ENSRNOT00000003600

RefSeq Acc Id:	XP_038942927 ⟸ XM_039086999
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GB03 (UniProtKB/TrEMBL), A1EC69 (UniProtKB/TrEMBL), Q5FWY7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083648 ⟸ ENSRNOT00000119012

Protein Domains

DEAD-box RNA helicase Q EH Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99PT0-F1-model_v2	AlphaFold	Q99PT0	1-598	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697543

Promoter ID:

EPDNEW_R8068

Type:

multiple initiation site

Name:

Ddx52_1

Description:

DExD-box helicase 52

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	71,253,659 - 71,253,719	EPDNEW

RGD ID:

13697550

Promoter ID:

EPDNEW_R8069

Type:

initiation region

Name:

AC105531_1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	71,278,654 - 71,278,714	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621743	AgrOrtholog
BioCyc Gene	G2FUF-23851	BioCyc
Ensembl Genes	ENSRNOG00000002612	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000053814	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000003600	ENTREZGENE
	ENSRNOT00000003600.7	UniProtKB/Swiss-Prot
	ENSRNOT00000119012	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7310368	IMAGE-MGC_LOAD
InterPro	DDX52/Rok1_DEADc	UniProtKB/Swiss-Prot
	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot
	DEAD_box_RNA_helicase	UniProtKB/Swiss-Prot
	Helicase_ATP-bd	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:85432	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105350	IMAGE-MGC_LOAD
NCBI Gene	85432	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE RHLE-RELATED	UniProtKB/Swiss-Prot
	RNA HELICASE	UniProtKB/Swiss-Prot
Pfam	DEAD	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
PhenoGen	Ddx52	PhenoGen
PROSITE	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot
	HELICASE_CTER	UniProtKB/Swiss-Prot
	Q_MOTIF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002612	RatGTEx
	ENSRNOG00000053814	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot
	HELICc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A0G2K0L4_RAT	UniProtKB/TrEMBL
	A0A8I6ASQ8_RAT	UniProtKB/TrEMBL
	A0A8I6GB03	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LUT0_RAT	UniProtKB/TrEMBL
	A1EC69	ENTREZGENE, UniProtKB/TrEMBL
	A6HHJ6	ENTREZGENE, UniProtKB/TrEMBL
	DDX52_RAT	UniProtKB/Swiss-Prot
	Q5FWY7	ENTREZGENE, UniProtKB/TrEMBL
	Q99PT0	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-10-05	Ddx52	DExD-box helicase 52	Ddx52	DEAD-box helicase 52	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-13	Ddx52	DEAD-box helicase 52	Ddx52	DEAD (Asp-Glu-Ala-Asp) box polypeptide 52	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ddx52	DEAD (Asp-Glu-Ala-Asp) box polypeptide 52		ATP-dependent, RNA helicase	Name updated	1299863	APPROVED
2004-09-10	Ddx52	ATP-dependent, RNA helicase	Rok1		Symbol and Name updated	1299863	APPROVED
2002-08-07	Rok1	ATP-dependent, RNA helicase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype