Symbol:
Egr2
Name:
early growth response 2
RGD ID:
621608
Description:
Enables HMG box domain binding activity. Involved in learning or memory; regulation of neuronal synaptic plasticity; and response to insulin. Predicted to be located in cytoplasm and nucleoplasm. Biomarker of middle cerebral artery infarction. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease type 1D; Charcot-Marie-Tooth disease type 3; Charcot-Marie-Tooth disease type 4E; and motor peripheral neuropathy. Orthologous to human EGR2 (early growth response 2); PARTICIPATES IN interleukin-4 signaling pathway; INTERACTS WITH (+)-pilocarpine; 1,2-dimethylhydrazine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E3 SUMO-protein ligase EGR2; E3 SUMO-protein transferase ERG2; early growth response protein 2; EGR-2; Krox20; zinc finger protein Krox-20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EGR2 (early growth response 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Egr2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Egr2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EGR2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EGR2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Egr2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EGR2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EGR2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Egr2 (early growth response 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Egr2 (early growth response 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
EGR2 (early growth response 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
egr2b (early growth response 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
sr
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
egrh-2
Alliance
DIOPT (Hieranoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
STP4
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
STP3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Xenopus tropicalis (tropical clawed frog):
egr2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 21,050,149 - 21,055,201 (-) NCBI GRCr8 mRatBN7.2 20 21,051,270 - 21,056,322 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 21,051,277 - 21,055,562 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 21,775,449 - 21,779,741 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 21,128,510 - 21,132,802 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 21,605,990 - 21,610,282 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 22,452,170 - 22,461,018 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 22,454,463 - 22,459,025 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 24,551,935 - 24,556,227 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 21,883,885 - 21,888,177 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 21,897,685 - 21,901,977 (-) NCBI Celera 20 22,412,625 - 22,416,917 (-) NCBI Celera Cytogenetic Map 20 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Egr2 Rat (+)-pilocarpine multiple interactions EXP 6480464 Atropine inhibits the reaction [Pilocarpine results in increased expression of EGR2 mRNA] and Pirenzepine inhibits the reaction [Pilocarpine results in increased expression of EGR2 mRNA] CTD PMID:7968354 Egr2 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of EGR2 mRNA CTD PMID:7968354 Egr2 Rat (-)-demecolcine increases expression ISO EGR2 (Homo sapiens) 6480464 Demecolcine results in increased expression of EGR2 mRNA CTD PMID:23649840 Egr2 Rat (S)-nicotine increases expression ISO Egr2 (Mus musculus) 6480464 Nicotine results in increased expression of EGR2 mRNA CTD PMID:17456735 Egr2 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of EGR2 mRNA CTD PMID:27840820 Egr2 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO EGR2 (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of EGR2 mRNA CTD PMID:17374397 Egr2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Egr2 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:28801915 Egr2 Rat 17beta-estradiol affects expression ISO Egr2 (Mus musculus) 6480464 Estradiol affects the expression of EGR2 mRNA CTD PMID:15598610 Egr2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of EGR2 mRNA CTD PMID:32741896 Egr2 Rat 17beta-estradiol increases expression ISO Egr2 (Mus musculus) 6480464 Estradiol results in increased expression of EGR2 mRNA CTD PMID:19484750 Egr2 Rat 17beta-estradiol multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of EGR2 mRNA more ... CTD PMID:20404318 more ... Egr2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of EGR2 mRNA CTD PMID:32741896 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Egr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EGR2 mRNA CTD PMID:21570461 and PMID:24058054 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects methylation ISO EGR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the methylation of EGR2 5' UTR more ... CTD PMID:28011154 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO EGR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of EGR2 mRNA CTD PMID:22298810 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO EGR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EGR2 mRNA CTD PMID:21296121 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Egr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EGR2 mRNA CTD PMID:19770486 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Egr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EGR2 mRNA CTD PMID:16962184 Egr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO EGR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of EGR2 mRNA CTD PMID:20106945 and PMID:30096437 Egr2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Egr2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Egr2 Rat 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine multiple interactions ISO Egr2 (Mus musculus) 6480464 Risperidone inhibits the reaction [Toluene promotes the reaction [4-iodo-2 more ... CTD PMID:32980479 Egr2 Rat 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine increases expression ISO Egr2 (Mus musculus) 6480464 4-iodo-2 and 5-dimethoxyphenylisopropylamine results in increased expression of EGR2 protein CTD PMID:32980479 Egr2 Rat 2-butoxyethanol increases expression ISO Egr2 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of EGR2 mRNA CTD PMID:19812364 Egr2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Egr2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of EGR2 mRNA CTD PMID:20188158 Egr2 Rat 3-methylcholanthrene increases expression ISO Egr2 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of EGR2 mRNA CTD PMID:29554273 Egr2 Rat 3alpha-hydroxy-5beta-pregnan-20-one increases expression EXP 6480464 Pregnanolone results in increased expression of EGR2 mRNA and Pregnanolone results in increased expression of EGR2 protein CTD PMID:17478888 Egr2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Egr2 (Mus musculus) 6480464 bisphenol S affects the methylation of EGR2 gene CTD PMID:31683443 Egr2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO EGR2 (Homo sapiens) 6480464 Oxazolone results in decreased expression of EGR2 mRNA CTD PMID:17374397 Egr2 Rat 4-nitrophenol decreases expression ISO Egr2 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of EGR2 mRNA CTD PMID:34673133 Egr2 Rat 5-azacytidine increases expression ISO EGR2 (Homo sapiens) 6480464 Azacitidine results in increased expression of EGR2 mRNA CTD PMID:20823114 Egr2 Rat 5alpha-pregnane-3,20-dione increases expression EXP 6480464 5-alpha-Dihydroprogesterone results in increased expression of EGR2 mRNA and 5-alpha-Dihydroprogesterone results in increased expression of EGR2 protein CTD PMID:17478888 Egr2 Rat 7,12-dimethyltetraphene multiple interactions ISO Egr2 (Mus musculus) 6480464 [CYP1B1 protein affects the susceptibility to 9 more ... CTD PMID:27891153 Egr2 Rat 8-Br-cAMP increases expression ISO EGR2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of EGR2 mRNA CTD PMID:20147733 and PMID:22079614 Egr2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EGR2 mRNA CTD PMID:31881176 Egr2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of EGR2 mRNA CTD PMID:32151602 Egr2 Rat actinomycin D multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of EGR2 mRNA CTD PMID:38460933 Egr2 Rat aflatoxin B1 affects expression ISO EGR2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of EGR2 protein CTD PMID:20106945 Egr2 Rat aflatoxin B1 increases expression ISO EGR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of EGR2 mRNA CTD PMID:21632981 more ... Egr2 Rat aldehydo-D-glucose multiple interactions ISO Egr2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of EGR2 mRNA CTD PMID:37567420 Egr2 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of EGR2 mRNA CTD PMID:20488242 and PMID:22664269 Egr2 Rat all-trans-retinoic acid decreases expression ISO Egr2 (Mus musculus) 6480464 Tretinoin results in decreased expression of EGR2 mRNA CTD PMID:36189433 Egr2 Rat all-trans-retinoic acid multiple interactions ISO Egr2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of EGR2 mRNA CTD PMID:36189433 Egr2 Rat all-trans-retinoic acid increases expression ISO EGR2 (Homo sapiens) 6480464 Tretinoin results in increased expression of EGR2 mRNA CTD PMID:21934132 more ... Egr2 Rat amiodarone increases expression ISO EGR2 (Homo sapiens) 6480464 Amiodarone results in increased expression of EGR2 mRNA CTD PMID:19774075 Egr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of EGR2 mRNA CTD PMID:16483693 Egr2 Rat aripiprazole increases expression EXP 6480464 Aripiprazole results in increased expression of EGR2 mRNA CTD PMID:17868501 Egr2 Rat aristolochic acid A decreases expression ISO EGR2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of EGR2 mRNA CTD PMID:33212167 Egr2 Rat arsane affects methylation ISO EGR2 (Homo sapiens) 6480464 Arsenic affects the methylation of EGR2 gene CTD PMID:25304211 Egr2 Rat arsenic atom affects methylation ISO EGR2 (Homo sapiens) 6480464 Arsenic affects the methylation of EGR2 gene CTD PMID:25304211 Egr2 Rat arsenous acid multiple interactions ISO EGR2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide results in decreased expression of EGR2 mRNA] CTD PMID:19350554 Egr2 Rat arsenous acid decreases expression ISO EGR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EGR2 mRNA CTD PMID:19128835 and PMID:19350554 Egr2 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of EGR2 mRNA CTD PMID:36841081 Egr2 Rat atropine multiple interactions EXP 6480464 Atropine inhibits the reaction [Pilocarpine results in increased expression of EGR2 mRNA] CTD PMID:7968354 Egr2 Rat azathioprine increases expression ISO EGR2 (Homo sapiens) 6480464 Azathioprine results in increased expression of EGR2 mRNA CTD PMID:22623647 Egr2 Rat baicalein decreases expression ISO Egr2 (Mus musculus) 6480464 baicalein results in decreased expression of EGR2 mRNA CTD PMID:24560969 Egr2 Rat bathocuproine disulfonic acid multiple interactions ISO EGR2 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of EGR2 mRNA] CTD PMID:15477007 Egr2 Rat bazedoxifene increases expression ISO EGR2 (Homo sapiens) 6480464 bazedoxifene results in increased expression of EGR2 mRNA CTD PMID:19914376 Egr2 Rat benzene decreases expression ISO Egr2 (Mus musculus) 6480464 Benzene results in decreased expression of EGR2 mRNA CTD PMID:15120971 and PMID:15122651 Egr2 Rat benzene increases expression ISO EGR2 (Homo sapiens) 6480464 Benzene results in increased expression of EGR2 mRNA CTD PMID:19162166 Egr2 Rat benzo[a]pyrene decreases expression ISO Egr2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of EGR2 mRNA CTD PMID:19770486 Egr2 Rat benzo[a]pyrene increases methylation ISO Egr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of EGR2 3' UTR and Benzo(a)pyrene results in increased methylation of EGR2 exon CTD PMID:27901495 Egr2 Rat benzo[a]pyrene affects methylation ISO EGR2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of EGR2 3' UTR CTD PMID:27901495 Egr2 Rat benzo[a]pyrene increases methylation ISO EGR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EGR2 5' UTR and Benzo(a)pyrene results in increased methylation of EGR2 promoter CTD PMID:27901495 Egr2 Rat benzo[a]pyrene increases expression ISO EGR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of EGR2 mRNA CTD PMID:20106945 more ... Egr2 Rat benzo[a]pyrene increases expression ISO Egr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EGR2 mRNA CTD PMID:22228805 Egr2 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of EGR2 mRNA CTD PMID:21839799 Egr2 Rat beryllium sulfate increases expression ISO EGR2 (Homo sapiens) 6480464 beryllium sulfate results in increased expression of EGR2 mRNA CTD PMID:16314022 Egr2 Rat beta-lapachone increases expression ISO EGR2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of EGR2 mRNA CTD PMID:38218311 Egr2 Rat bis(2-chloroethyl) sulfide increases expression ISO Egr2 (Mus musculus) 6480464 Mustard Gas results in increased expression of EGR2 mRNA CTD PMID:15674843 Egr2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO EGR2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of EGR2 mRNA CTD PMID:31163220 Egr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EGR2 mRNA CTD PMID:25181051 and PMID:36803626 Egr2 Rat bisphenol A decreases expression ISO Egr2 (Mus musculus) 6480464 bisphenol A results in decreased expression of EGR2 mRNA CTD PMID:35598803 Egr2 Rat bisphenol A affects methylation ISO Egr2 (Mus musculus) 6480464 bisphenol A affects the methylation of EGR2 promoter CTD PMID:27334623 Egr2 Rat bisphenol F increases expression ISO Egr2 (Mus musculus) 6480464 bisphenol F results in increased expression of EGR2 mRNA CTD PMID:38685157 Egr2 Rat bleomycin A2 affects expression ISO Egr2 (Mus musculus) 6480464 Bleomycin affects the expression of EGR2 mRNA CTD PMID:26345256 Egr2 Rat bortezomib decreases expression ISO Egr2 (Mus musculus) 6480464 Bortezomib results in decreased expression of EGR2 mRNA CTD PMID:20830808 Egr2 Rat bortezomib decreases expression EXP 6480464 Bortezomib results in decreased expression of EGR2 mRNA and Bortezomib results in decreased expression of EGR2 protein CTD PMID:20830808 Egr2 Rat bucladesine multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of EGR2 mRNA CTD PMID:20823114 Egr2 Rat butanal increases expression ISO EGR2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of EGR2 mRNA CTD PMID:26079696 Egr2 Rat C.I. Natural Red 20 multiple interactions ISO Egr2 (Mus musculus) 6480464 shikonin inhibits the reaction [Antigen-Antibody Complex results in increased expression of EGR2 mRNA] and shikonin inhibits the reaction [Calcimycin results in increased expression of EGR2 mRNA] CTD PMID:25451590 Egr2 Rat cadmium atom increases expression ISO EGR2 (Homo sapiens) 6480464 Cadmium results in increased expression of EGR2 mRNA CTD PMID:21694771 Egr2 Rat cadmium atom multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of EGR2 mRNA CTD PMID:35301059 Egr2 Rat cadmium dichloride multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of EGR2 mRNA CTD PMID:35301059 Egr2 Rat Calcimycin increases expression ISO Egr2 (Mus musculus) 6480464 Calcimycin results in increased expression of EGR2 mRNA CTD PMID:25451590 Egr2 Rat Calcimycin multiple interactions ISO Egr2 (Mus musculus) 6480464 shikonin inhibits the reaction [Calcimycin results in increased expression of EGR2 mRNA] CTD PMID:25451590 Egr2 Rat carbon nanotube increases expression ISO Egr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Egr2 Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of EGR2 mRNA CTD PMID:18500788 Egr2 Rat chloroprene decreases expression ISO Egr2 (Mus musculus) 6480464 Chloroprene results in decreased expression of EGR2 mRNA CTD PMID:23125180 Egr2 Rat chlorpyrifos decreases expression ISO Egr2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of EGR2 mRNA CTD PMID:20350560 Egr2 Rat choline multiple interactions ISO Egr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EGR2 mRNA CTD PMID:20938992 Egr2 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of EGR2 mRNA CTD PMID:22023808 Egr2 Rat cisplatin increases expression ISO EGR2 (Homo sapiens) 6480464 Cisplatin results in increased expression of EGR2 mRNA CTD PMID:27392435 Egr2 Rat cisplatin multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of EGR2 mRNA CTD PMID:27392435 Egr2 Rat clofibrate multiple interactions ISO Egr2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of EGR2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of EGR2 mRNA] CTD PMID:17585979 Egr2 Rat clofibrate decreases expression ISO Egr2 (Mus musculus) 6480464 Clofibrate results in decreased expression of EGR2 mRNA CTD PMID:17585979 Egr2 Rat clozapine affects expression ISO Egr2 (Mus musculus) 6480464 Clozapine affects the expression of EGR2 mRNA CTD PMID:19401217 Egr2 Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of EGR2 protein CTD PMID:17028028 Egr2 Rat cocaine increases expression ISO Egr2 (Mus musculus) 6480464 Cocaine results in increased expression of EGR2 mRNA CTD PMID:20056891 Egr2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of EGR2 mRNA CTD PMID:27899881 Egr2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of EGR2 mRNA CTD PMID:20187946 Egr2 Rat copper atom increases expression ISO EGR2 (Homo sapiens) 6480464 Copper results in increased expression of EGR2 CTD PMID:24403277 Egr2 Rat copper(0) increases expression ISO EGR2 (Homo sapiens) 6480464 Copper results in increased expression of EGR2 CTD PMID:24403277 Egr2 Rat copper(II) sulfate increases expression ISO EGR2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of EGR2 mRNA CTD PMID:19549813 Egr2 Rat crocidolite asbestos increases expression ISO EGR2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of EGR2 mRNA CTD PMID:18687144 Egr2 Rat crocidolite asbestos increases expression ISO Egr2 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of EGR2 mRNA CTD PMID:29279043 Egr2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EGR2 mRNA CTD PMID:27523638 Egr2 Rat cycloheximide increases expression ISO EGR2 (Homo sapiens) 6480464 Cycloheximide results in increased expression of EGR2 mRNA CTD PMID:19350554 Egr2 Rat cyclophosphamide decreases expression ISO Egr2 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of EGR2 mRNA CTD PMID:21041162 Egr2 Rat cyclosporin A multiple interactions ISO Egr2 (Mus musculus) 6480464 Cyclosporine inhibits the reaction [Zymosan results in increased expression of EGR2 mRNA] CTD PMID:17312158 Egr2 Rat cyclosporin A increases expression ISO EGR2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of EGR2 mRNA CTD PMID:20106945 more ... Egr2 Rat cyclosporin A decreases expression ISO Egr2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of EGR2 mRNA CTD PMID:25224403 Egr2 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of EGR2 mRNA CTD PMID:21865292 Egr2 Rat cyproconazole decreases expression EXP 6480464 cyproconazole results in decreased expression of EGR2 mRNA CTD PMID:22664269 Egr2 Rat D-glucose multiple interactions ISO Egr2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of EGR2 mRNA CTD PMID:37567420 Egr2 Rat DDT increases expression EXP 6480464 DDT results in increased expression of EGR2 mRNA CTD PMID:30207508 Egr2 Rat dexamethasone decreases expression ISO Egr2 (Mus musculus) 6480464 Dexamethasone results in decreased expression of EGR2 mRNA CTD PMID:21041162 and PMID:22733784 Egr2 Rat dexamethasone decreases expression ISO EGR2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of EGR2 mRNA CTD PMID:25047013 Egr2 Rat diarsenic trioxide multiple interactions ISO EGR2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide results in decreased expression of EGR2 mRNA] CTD PMID:19350554 Egr2 Rat diarsenic trioxide decreases expression ISO EGR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EGR2 mRNA CTD PMID:19128835 and PMID:19350554 Egr2 Rat Dibutyl phosphate affects expression ISO EGR2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EGR2 mRNA CTD PMID:37042841 Egr2 Rat dibutyl phthalate increases expression ISO Egr2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of EGR2 mRNA CTD PMID:17361019 and PMID:21266533 Egr2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of EGR2 mRNA CTD PMID:21266533 and PMID:21745491 Egr2 Rat dichloroacetic acid increases expression ISO Egr2 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of EGR2 mRNA CTD PMID:28962523 Egr2 Rat dieldrin increases expression ISO EGR2 (Homo sapiens) 6480464 Dieldrin results in increased expression of EGR2 mRNA CTD PMID:31068361 Egr2 Rat diethylstilbestrol decreases expression ISO Egr2 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of EGR2 mRNA CTD PMID:21041162 Egr2 Rat dioxygen multiple interactions ISO Egr2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of EGR2 mRNA CTD PMID:30529165 Egr2 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of EGR2 mRNA CTD PMID:33729688 Egr2 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of EGR2 mRNA CTD PMID:25152437 Egr2 Rat dorsomorphin multiple interactions ISO EGR2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EGR2 mRNA CTD PMID:27188386 Egr2 Rat doxorubicin affects expression ISO Egr2 (Mus musculus) 6480464 Doxorubicin affects the expression of EGR2 mRNA CTD PMID:15033991 Egr2 Rat doxorubicin increases expression ISO Egr2 (Mus musculus) 6480464 Doxorubicin results in increased expression of EGR2 mRNA CTD PMID:36227756 Egr2 Rat doxorubicin decreases expression ISO EGR2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of EGR2 mRNA CTD PMID:29803840 Egr2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of EGR2 mRNA CTD PMID:29391264 Egr2 Rat ethanol affects expression ISO Egr2 (Mus musculus) 6480464 Ethanol affects the expression of EGR2 mRNA CTD PMID:30319688 Egr2 Rat ethyl methanesulfonate increases expression ISO EGR2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of EGR2 mRNA CTD PMID:23649840 Egr2 Rat eugenol decreases expression ISO EGR2 (Homo sapiens) 6480464 Eugenol results in decreased expression of EGR2 mRNA CTD PMID:17374397 Egr2 Rat ferric oxide increases expression ISO Egr2 (Mus musculus) 6480464 ferric oxide analog results in increased expression of EGR2 mRNA CTD PMID:24525745 and PMID:25086211 Egr2 Rat fluoranthene multiple interactions ISO Egr2 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of EGR2 mRNA CTD PMID:28329830 Egr2 Rat flusilazole decreases expression EXP 6480464 flusilazole results in decreased expression of EGR2 mRNA CTD PMID:22664269 Egr2 Rat folic acid multiple interactions ISO Egr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EGR2 mRNA CTD PMID:20938992 Egr2 Rat folic acid affects expression ISO Egr2 (Mus musculus) 6480464 Folic Acid deficiency affects the expression of EGR2 mRNA CTD PMID:32304770 Egr2 Rat formaldehyde increases expression ISO EGR2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of EGR2 mRNA CTD PMID:17938736 and PMID:28937961 Egr2 Rat formaldehyde multiple interactions ISO EGR2 (Homo sapiens) 6480464 Formaldehyde inhibits the reaction [H3-3A protein binds to EGR2 promoter] CTD PMID:28937961 Egr2 Rat formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of EGR2 mRNA CTD PMID:18499655 Egr2 Rat fructose multiple interactions ISO Egr2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of EGR2 mRNA CTD PMID:37567420 Egr2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of EGR2 gene CTD PMID:22079235 Egr2 Rat furan increases expression EXP 6480464 furan results in increased expression of EGR2 mRNA CTD PMID:27387713 Egr2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EGR2 mRNA CTD PMID:33387578 Egr2 Rat glucose multiple interactions ISO Egr2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of EGR2 mRNA CTD PMID:37567420 Egr2 Rat haloperidol affects expression ISO Egr2 (Mus musculus) 6480464 Haloperidol affects the expression of EGR2 mRNA CTD PMID:19401217 Egr2 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of EGR2 mRNA CTD PMID:18208916 Egr2 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of EGR2 protein CTD PMID:17028028 Egr2 Rat hydrogen peroxide affects expression ISO EGR2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of EGR2 mRNA CTD PMID:20044591 Egr2 Rat ionomycin multiple interactions ISO EGR2 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of EGR2 mRNA] more ... CTD PMID:15477007 Egr2 Rat L-methionine multiple interactions ISO Egr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EGR2 mRNA CTD PMID:20938992 Egr2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of EGR2 mRNA CTD PMID:22641619 Egr2 Rat lead diacetate increases methylation EXP 6480464 lead acetate results in increased methylation of EGR2 gene CTD PMID:29571894 Egr2 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of EGR2 mRNA CTD PMID:35283115 Egr2 Rat manganese(II) chloride increases expression ISO Egr2 (Mus musculus) 6480464 manganese chloride results in increased expression of EGR2 mRNA CTD PMID:28801915 Egr2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of EGR2 mRNA CTD PMID:28801915 Egr2 Rat medroxyprogesterone acetate multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of EGR2 mRNA CTD PMID:20823114 Egr2 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of EGR2 mRNA CTD PMID:15644446 and PMID:19564919 Egr2 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of EGR2 gene CTD PMID:19589859 Egr2 Rat methylisothiazolinone increases expression ISO EGR2 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of EGR2 mRNA CTD PMID:31629900 Egr2 Rat methylmercury chloride increases expression ISO EGR2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of EGR2 mRNA CTD PMID:28001369 Egr2 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of EGR2 mRNA CTD PMID:31378766 Egr2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Egr2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of EGR2 mRNA CTD PMID:36189433 Egr2 Rat Monobutylphthalate affects expression ISO Egr2 (Mus musculus) 6480464 monobutyl phthalate affects the expression of EGR2 mRNA CTD PMID:19162170 Egr2 Rat morphine increases expression ISO Egr2 (Mus musculus) 6480464 Morphine results in increased expression of EGR2 mRNA CTD PMID:22454534 Egr2 Rat N-acetyl-L-cysteine multiple interactions ISO EGR2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [arsenic trioxide results in decreased expression of EGR2 mRNA] CTD PMID:19350554 Egr2 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of EGR2 mRNA CTD PMID:28801915 Egr2 Rat N-methyl-4-phenylpyridinium increases methylation EXP 6480464 1-Methyl-4-phenylpyridinium results in increased methylation of EGR2 gene CTD PMID:28801915 Egr2 Rat N-Nitrosopyrrolidine increases expression ISO EGR2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of EGR2 mRNA CTD PMID:32234424 Egr2 Rat naphthalene increases expression ISO Egr2 (Mus musculus) 6480464 naphthalene results in increased expression of EGR2 mRNA CTD PMID:18978301 Egr2 Rat nicotine increases expression ISO Egr2 (Mus musculus) 6480464 Nicotine results in increased expression of EGR2 mRNA CTD PMID:17456735 Egr2 Rat nicotinic acid increases expression EXP 6480464 Niacin results in increased expression of EGR2 mRNA CTD PMID:20303128 Egr2 Rat Nutlin-3 multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of EGR2 mRNA CTD PMID:38460933 Egr2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of EGR2 mRNA CTD PMID:25729387 Egr2 Rat ozone multiple interactions ISO Egr2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of EGR2 mRNA and TTPA protein affects the reaction [Ozone results in increased expression of EGR2 mRNA] CTD PMID:19555225 and PMID:34911549 Egr2 Rat ozone multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of EGR2 mRNA CTD PMID:35430440 Egr2 Rat p-chloromercuribenzoic acid multiple interactions ISO EGR2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EGR2 mRNA CTD PMID:27188386 Egr2 Rat palytoxin increases expression ISO Egr2 (Mus musculus) 6480464 palytoxin results in increased expression of EGR2 mRNA CTD PMID:26436198 Egr2 Rat paracetamol multiple interactions ISO Egr2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of EGR2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of EGR2 mRNA] CTD PMID:17585979 Egr2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of EGR2 mRNA CTD PMID:33387578 Egr2 Rat paracetamol increases expression ISO EGR2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of EGR2 mRNA CTD PMID:29067470 Egr2 Rat paracetamol affects expression ISO Egr2 (Mus musculus) 6480464 Acetaminophen affects the expression of EGR2 mRNA CTD PMID:17562736 Egr2 Rat pentanal increases expression ISO EGR2 (Homo sapiens) 6480464 pentanal results in increased expression of EGR2 mRNA CTD PMID:26079696 Egr2 Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of EGR2 mRNA CTD PMID:25710175 Egr2 Rat phenobarbital decreases expression ISO Egr2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of EGR2 mRNA CTD PMID:19270015 Egr2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO EGR2 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of EGR2 mRNA] more ... CTD PMID:15477007 Egr2 Rat phorbol 13-acetate 12-myristate increases expression ISO EGR2 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of EGR2 mRNA CTD PMID:31068361 Egr2 Rat phosgene affects expression ISO Egr2 (Mus musculus) 6480464 Phosgene affects the expression of EGR2 mRNA CTD PMID:16300373 Egr2 Rat pirenzepine multiple interactions EXP 6480464 Pirenzepine inhibits the reaction [Pilocarpine results in increased expression of EGR2 mRNA] CTD PMID:7968354 Egr2 Rat pirinixic acid increases expression ISO Egr2 (Mus musculus) 6480464 pirinixic acid results in increased expression of EGR2 mRNA CTD PMID:23811191 Egr2 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Egr2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of EGR2 mRNA CTD PMID:22698814 Egr2 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of EGR2 mRNA and Progesterone results in increased expression of EGR2 protein CTD PMID:17478888 Egr2 Rat progesterone multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of EGR2 mRNA CTD PMID:20660070 Egr2 Rat propanal increases expression ISO EGR2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of EGR2 mRNA CTD PMID:26079696 Egr2 Rat pyrrolidine dithiocarbamate multiple interactions ISO EGR2 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of EGR2 mRNA] and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of EGR2 mRNA] CTD PMID:15477007 Egr2 Rat quercetin increases expression ISO EGR2 (Homo sapiens) 6480464 Quercetin results in increased expression of EGR2 mRNA CTD PMID:21632981 Egr2 Rat quercitrin increases expression ISO EGR2 (Homo sapiens) 6480464 quercitrin results in increased expression of EGR2 mRNA CTD PMID:25193878 Egr2 Rat rifampicin multiple interactions ISO EGR2 (Homo sapiens) 6480464 [Rifampin co-treated with NR1I2 protein] results in increased expression of EGR2 mRNA CTD PMID:21127053 Egr2 Rat risperidone decreases expression EXP 6480464 Risperidone results in decreased expression of EGR2 protein CTD PMID:17028028 Egr2 Rat risperidone multiple interactions ISO Egr2 (Mus musculus) 6480464 Risperidone inhibits the reaction [Toluene promotes the reaction [4-iodo-2 and 5-dimethoxyphenylisopropylamine results in increased expression of EGR2 protein]] CTD PMID:32980479 Egr2 Rat SB 431542 multiple interactions ISO EGR2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EGR2 mRNA CTD PMID:27188386 Egr2 Rat SCH 23390 decreases expression EXP 6480464 SCH 23390 results in decreased expression of EGR2 mRNA CTD PMID:19564919 Egr2 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of EGR2 mRNA CTD PMID:17540011 Egr2 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of EGR2 mRNA CTD PMID:15967596 Egr2 Rat Shikonin multiple interactions ISO Egr2 (Mus musculus) 6480464 shikonin inhibits the reaction [Antigen-Antibody Complex results in increased expression of EGR2 mRNA] and shikonin inhibits the reaction [Calcimycin results in increased expression of EGR2 mRNA] CTD PMID:25451590 Egr2 Rat silicon dioxide decreases expression ISO EGR2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of EGR2 mRNA CTD PMID:25895662 Egr2 Rat silicon dioxide increases expression ISO Egr2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of EGR2 mRNA CTD PMID:19073995 more ... Egr2 Rat silicon dioxide increases expression ISO EGR2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of EGR2 mRNA CTD PMID:23806026 Egr2 Rat silicon dioxide affects expression ISO Egr2 (Mus musculus) 6480464 Silicon Dioxide affects the expression of EGR2 mRNA CTD PMID:19073995 Egr2 Rat silver atom increases expression ISO EGR2 (Homo sapiens) 6480464 Silver results in increased expression of EGR2 mRNA CTD PMID:26014281 and PMID:26551752 Egr2 Rat silver atom increases expression ISO Egr2 (Mus musculus) 6480464 Silver results in increased expression of EGR2 mRNA CTD PMID:27131904 Egr2 Rat silver(0) increases expression ISO EGR2 (Homo sapiens) 6480464 Silver results in increased expression of EGR2 mRNA CTD PMID:26014281 and PMID:26551752 Egr2 Rat silver(0) increases expression ISO Egr2 (Mus musculus) 6480464 Silver results in increased expression of EGR2 mRNA CTD PMID:27131904 Egr2 Rat sodium arsenate decreases expression ISO Egr2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of EGR2 mRNA CTD PMID:21795629 Egr2 Rat sodium arsenite increases expression ISO EGR2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of EGR2 mRNA CTD PMID:29301061 and PMID:38568856 Egr2 Rat sodium arsenite decreases expression ISO Egr2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of EGR2 mRNA CTD PMID:37682722 Egr2 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of EGR2 mRNA CTD PMID:27257137 Egr2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of EGR2 mRNA CTD PMID:19281266 Egr2 Rat succimer multiple interactions ISO Egr2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of EGR2 mRNA more ... CTD PMID:21641980 and PMID:26378955 Egr2 Rat sunitinib increases expression ISO EGR2 (Homo sapiens) 6480464 Sunitinib results in increased expression of EGR2 mRNA CTD PMID:31533062 Egr2 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of EGR2 mRNA CTD PMID:21865292 Egr2 Rat temozolomide decreases expression ISO EGR2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of EGR2 mRNA CTD PMID:31758290 Egr2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of EGR2 mRNA CTD PMID:32741896 Egr2 Rat tetrachloromethane increases expression ISO Egr2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of EGR2 mRNA CTD PMID:27339419 and PMID:31919559 Egr2 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of EGR2 mRNA CTD PMID:20830808 Egr2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EGR2 mRNA CTD PMID:34492290 Egr2 Rat titanium dioxide increases expression ISO Egr2 (Mus musculus) 6480464 titanium dioxide analog results in increased expression of EGR2 mRNA and titanium dioxide results in increased expression of EGR2 mRNA CTD PMID:23557971 and PMID:25111187 Egr2 Rat titanium dioxide increases methylation ISO Egr2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of EGR2 promoter CTD PMID:35295148 Egr2 Rat titanium dioxide decreases methylation ISO Egr2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EGR2 promoter CTD PMID:35295148 Egr2 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of EGR2 mRNA CTD PMID:30012374 Egr2 Rat toluene multiple interactions ISO Egr2 (Mus musculus) 6480464 Risperidone inhibits the reaction [Toluene promotes the reaction [4-iodo-2 more ... CTD PMID:32980479 Egr2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of EGR2 mRNA CTD PMID:25729387 Egr2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of EGR2 mRNA CTD PMID:25729387 Egr2 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of EGR2 mRNA CTD PMID:22664269 Egr2 Rat triazoles decreases expression EXP 6480464 Triazoles results in decreased expression of EGR2 mRNA CTD PMID:17343997 Egr2 Rat tributylstannane increases expression ISO EGR2 (Homo sapiens) 6480464 tributyltin results in increased expression of EGR2 mRNA CTD PMID:28011154 Egr2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of EGR2 mRNA CTD PMID:33387578 Egr2 Rat trichostatin A decreases expression ISO EGR2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of EGR2 mRNA CTD PMID:24935251 Egr2 Rat trichostatin A affects expression ISO EGR2 (Homo sapiens) 6480464 trichostatin A affects the expression of EGR2 mRNA CTD PMID:28542535 Egr2 Rat trichostatin A increases expression ISO EGR2 (Homo sapiens) 6480464 trichostatin A results in increased expression of EGR2 mRNA CTD PMID:24935251 Egr2 Rat trimellitic anhydride increases expression ISO Egr2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of EGR2 mRNA CTD PMID:19042947 Egr2 Rat triphenyl phosphate affects expression ISO EGR2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EGR2 mRNA CTD PMID:37042841 Egr2 Rat triptonide increases expression ISO Egr2 (Mus musculus) 6480464 triptonide results in increased expression of EGR2 mRNA CTD PMID:33045310 Egr2 Rat tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate multiple interactions EXP 6480464 Atropine inhibits the reaction [Pilocarpine results in increased expression of EGR2 mRNA] CTD PMID:7968354 Egr2 Rat urethane increases expression ISO EGR2 (Homo sapiens) 6480464 Urethane results in increased expression of EGR2 mRNA CTD PMID:28818685 Egr2 Rat valproic acid decreases expression ISO Egr2 (Mus musculus) 6480464 Valproic Acid results in decreased expression of EGR2 mRNA CTD PMID:15799026 Egr2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of EGR2 mRNA CTD PMID:35594946 Egr2 Rat valproic acid increases expression ISO EGR2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of EGR2 mRNA CTD PMID:23179753 more ... Egr2 Rat valproic acid decreases expression ISO EGR2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of EGR2 mRNA CTD PMID:24935251 and PMID:28001369 Egr2 Rat valproic acid affects expression ISO EGR2 (Homo sapiens) 6480464 Valproic Acid affects the expression of EGR2 mRNA CTD PMID:25979313 Egr2 Rat valproic acid increases methylation ISO EGR2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of EGR2 gene CTD PMID:29154799 Egr2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of EGR2 mRNA CTD PMID:19015723 Egr2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of EGR2 mRNA CTD PMID:30207508 Egr2 Rat zinc atom multiple interactions ISO EGR2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of EGR2 mRNA CTD PMID:18593933 Egr2 Rat zinc(0) multiple interactions ISO EGR2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of EGR2 mRNA CTD PMID:18593933 Egr2 Rat zoledronic acid increases expression ISO EGR2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of EGR2 mRNA CTD PMID:20977926
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (-)-demecolcine (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine (ISO) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 3alpha-hydroxy-5beta-pregnan-20-one (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-nitrophenol (ISO) 5-azacytidine (ISO) 5alpha-pregnane-3,20-dione (EXP) 7,12-dimethyltetraphene (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) amiodarone (ISO) ammonium chloride (EXP) aripiprazole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) atropine (EXP) azathioprine (ISO) baicalein (ISO) bathocuproine disulfonic acid (ISO) bazedoxifene (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) beryllium sulfate (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) bortezomib (EXP,ISO) bucladesine (ISO) butanal (ISO) C.I. Natural Red 20 (ISO) cadmium atom (ISO) cadmium dichloride (ISO) Calcimycin (ISO) carbon nanotube (ISO) cefaloridine (EXP) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP,ISO) clofibrate (ISO) clozapine (EXP,ISO) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cycloheximide (ISO) cyclophosphamide (ISO) cyclosporin A (EXP,ISO) cyproconazole (EXP) D-glucose (ISO) DDT (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) dieldrin (ISO) diethylstilbestrol (ISO) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) eugenol (ISO) ferric oxide (ISO) fluoranthene (ISO) flusilazole (EXP) folic acid (ISO) formaldehyde (EXP,ISO) fructose (ISO) furan (EXP) gentamycin (EXP) glucose (ISO) haloperidol (EXP,ISO) hydrogen peroxide (ISO) ionomycin (ISO) L-methionine (ISO) lead diacetate (EXP) lidocaine (EXP) manganese(II) chloride (EXP,ISO) medroxyprogesterone acetate (ISO) methamphetamine (EXP) methoxychlor (EXP) methylisothiazolinone (ISO) methylmercury chloride (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) Monobutylphthalate (ISO) morphine (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (EXP) N-Nitrosopyrrolidine (ISO) naphthalene (ISO) nicotine (ISO) nicotinic acid (EXP) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) palytoxin (ISO) paracetamol (EXP,ISO) pentanal (ISO) pentane-2,3-dione (EXP) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) phosgene (ISO) pirenzepine (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) propanal (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (ISO) quercitrin (ISO) rifampicin (ISO) risperidone (EXP,ISO) SB 431542 (ISO) SCH 23390 (EXP) scopolamine (EXP) sevoflurane (EXP) Shikonin (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (EXP) Soman (EXP) succimer (ISO) sunitinib (ISO) tacrolimus hydrate (EXP) temozolomide (ISO) testosterone (EXP) tetrachloromethane (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (EXP,ISO) toluene (ISO) topotecan (EXP) triadimefon (EXP) triazoles (EXP) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
aorta development (ISO) brain segmentation (ISO) facial nerve structural organization (ISO,ISS) fat cell differentiation (ISO) gene expression (ISO) learning or memory (IEP) motor neuron axon guidance (ISO) myelination (ISO) positive regulation of DNA-templated transcription (ISO,ISS) positive regulation of myelination (ISO,ISS) positive regulation of Schwann cell differentiation (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO,ISS) protein export from nucleus (ISO,ISS) protein sumoylation (IEA,ISO) regulation of DNA-templated transcription (ISO) regulation of neuronal synaptic plasticity (IEP) regulation of ossification (ISO) regulation of transcription by RNA polymerase II (IBA) response to insulin (IMP) rhombomere 3 development (ISO) rhombomere 3 formation (ISO) rhombomere 3 structural organization (ISO,ISS) rhombomere 5 formation (ISO) rhombomere 5 structural organization (ISO,ISS) rhythmic behavior (ISO) Schwann cell differentiation (ISO,ISS) skeletal muscle cell differentiation (ISO,ISS)
Molecular Function
chromatin binding (ISO,ISS) DNA binding (IEA,ISO,TAS) DNA-binding transcription activator activity, RNA polymerase II-specific (ISO) DNA-binding transcription factor activity (ISO,ISS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO,ISS) HMG box domain binding (IPI) metal ion binding (IEA) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (ISO) sequence-specific DNA binding (ISO,ISS) sequence-specific double-stranded DNA binding (ISO) SUMO ligase activity (ISO) transcription cis-regulatory region binding (ISO,ISS) transferase activity (IEA) ubiquitin protein ligase binding (ISO) zinc ion binding (IEA)
1.
A novel mutation (D305V) in the early growth response 2 gene is associated with severe Charcot-Marie-Tooth type 1 disease.
Bellone E, etal., Hum Mutat 1999 Oct;14(4):353-4.
2.
EGR2 mutation R359W causes a spectrum of Dejerine-Sottas neuropathy.
Boerkoel CF, etal., Neurogenetics 2001 Jul;3(3):153-7.
3.
The ontogeny of Krox-20 expression in brainstem and cerebellar neurons.
De S, etal., J Chem Neuroanat 2003 Mar;25(3):213-26.
4.
Primary gene response to mechanical loading in healing rat Achilles tendons.
Eliasson P, etal., J Appl Physiol (1985). 2013 Jun;114(11):1519-26. doi: 10.1152/japplphysiol.01500.2012. Epub 2013 Mar 21.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Transcription of krox-20/egr-2 is upregulated after exposure to fibrous particles and adhesion in rat alveolar macrophages.
Hirano S, etal., Am J Respir Cell Mol Biol 2000 Sep;23(3):313-9.
8.
mRNA differential display reveals Krox-20 as a neural plasticity-regulated gene in the rat hippocampus.
Inokuchi K, etal., Biochem Biophys Res Commun 1996 Apr 16;221(2):430-6.
9.
Reorganization of pontine rhythmogenic neuronal networks in Krox-20 knockout mice.
Jacquin TD, etal., Neuron 1996 Oct;17(4):747-58.
10.
Insulin-regulated expression of Egr-1 and Krox20: dependence on ERK1/2 and interaction with p38 and PI3-kinase pathways.
Keeton AB, etal., Endocrinology. 2003 Dec;144(12):5402-10. Epub 2003 Sep 11.
11.
Erythropoietin-induced changes in brain gene expression reveal induction of synaptic plasticity genes in experimental stroke.
Mengozzi M, etal., Proc Natl Acad Sci U S A. 2012 Jun 12;109(24):9617-22. doi: 10.1073/pnas.1200554109. Epub 2012 May 29.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Screening of the early growth response 2 gene in Japanese patients with Charcot-Marie-Tooth disease type 1.
Numakura C, etal., J Neurol Sci 2003 Jun 15;210(1-2):61-4.
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
Regulation of the myelin gene periaxin provides evidence for Krox-20-independent myelin-related signalling in Schwann cells.
Parkinson DB, etal., Mol Cell Neurosci 2003 May;23(1):13-27.
17.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Frequency of mutations in the early growth response 2 gene associated with peripheral demyelinating neuropathies.
Vandenberghe N, etal., J Med Genet 2002 Dec;39(12):e81.
21.
Functional consequences of mutations in the early growth response 2 gene (EGR2) correlate with severity of human myelinopathies.
Warner LE, etal., Hum Mol Genet. 1999 Jul;8(7):1245-51.
22.
The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
Wissmuller S, etal., Nucleic Acids Res. 2006 Mar 31;34(6):1735-44. Print 2006.
Egr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 21,050,149 - 21,055,201 (-) NCBI GRCr8 mRatBN7.2 20 21,051,270 - 21,056,322 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 21,051,277 - 21,055,562 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 21,775,449 - 21,779,741 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 21,128,510 - 21,132,802 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 21,605,990 - 21,610,282 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 22,452,170 - 22,461,018 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 22,454,463 - 22,459,025 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 24,551,935 - 24,556,227 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 21,883,885 - 21,888,177 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 21,897,685 - 21,901,977 (-) NCBI Celera 20 22,412,625 - 22,416,917 (-) NCBI Celera Cytogenetic Map 20 p11 NCBI
EGR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 62,811,996 - 62,819,167 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 62,811,996 - 62,819,167 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 64,571,756 - 64,578,927 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 64,241,763 - 64,246,133 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 64,241,762 - 64,246,133 NCBI Celera 10 57,839,025 - 57,846,195 (-) NCBI Celera Cytogenetic Map 10 q21.3 NCBI HuRef 10 58,563,537 - 58,570,711 (-) NCBI HuRef CHM1_1 10 64,853,748 - 64,860,918 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 63,670,139 - 63,677,309 (-) NCBI T2T-CHM13v2.0
Egr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 67,370,334 - 67,383,354 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 67,371,305 - 67,378,018 (+) Ensembl GRCm39 Ensembl GRCm38 10 67,534,469 - 67,542,188 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 67,535,475 - 67,542,188 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 67,000,617 - 67,004,936 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 66,933,235 - 66,937,545 (+) NCBI MGSCv36 mm8 Celera 10 68,629,352 - 68,633,671 (+) NCBI Celera Cytogenetic Map 10 B5.1 NCBI cM Map 10 34.96 NCBI
Egr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 16,055,748 - 16,060,048 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 16,055,748 - 16,068,429 (-) NCBI ChiLan1.0 ChiLan1.0
EGR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 74,998,060 - 75,105,787 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 75,003,383 - 75,111,110 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 59,320,073 - 59,326,869 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 61,648,364 - 61,652,846 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 61,648,364 - 61,652,846 (-) Ensembl panpan1.1 panPan2
EGR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 14,705,384 - 14,810,130 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 14,706,600 - 14,709,497 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 14,923,311 - 15,027,362 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 14,969,904 - 15,074,026 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 14,969,462 - 14,976,019 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 14,952,564 - 15,056,593 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 15,077,597 - 15,181,626 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 15,433,193 - 15,537,238 (-) NCBI UU_Cfam_GSD_1.0
Egr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 66,381,281 - 66,388,026 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936753 1,958,264 - 1,962,640 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936753 1,958,250 - 1,962,640 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EGR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 66,284,581 - 66,291,299 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 66,280,665 - 66,291,308 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 71,516,963 - 71,523,663 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 14 q23-q25 NCBI
EGR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 68,472,640 - 68,479,612 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 68,475,102 - 68,479,595 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 29,356,837 - 29,363,580 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Egr2
.
Predicted Target Of
Count of predictions: 701 Count of miRNA genes: 303 Interacting mature miRNAs: 391 Transcripts: ENSRNOT00000000792 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat
X06746
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 21,051,577 - 21,051,768 (+) MAPPER mRatBN7.2 Rnor_6.0 20 22,454,769 - 22,454,959 NCBI Rnor6.0 Rnor_5.0 20 24,552,243 - 24,552,433 UniSTS Rnor5.0 RGSC_v3.4 20 21,884,193 - 21,884,383 UniSTS RGSC3.4 Celera 20 22,412,933 - 22,413,123 UniSTS Cytogenetic Map 20 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
110
82
82
51
25
51
6
209
96
91
45
56
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000792 ⟹ ENSRNOP00000000792
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 21,051,277 - 21,055,562 (-) Ensembl Rnor_6.0 Ensembl 20 22,454,463 - 22,459,025 (-) Ensembl
RefSeq Acc Id:
NM_053633 ⟹ NP_446085
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 21,050,149 - 21,054,441 (-) NCBI mRatBN7.2 20 21,051,270 - 21,055,562 (-) NCBI Rnor_6.0 20 22,454,461 - 22,458,753 (-) NCBI Rnor_5.0 20 24,551,935 - 24,556,227 (-) NCBI RGSC_v3.4 20 21,883,885 - 21,888,177 (-) RGD Celera 20 22,412,625 - 22,416,917 (-) RGD
Sequence:
GCGATTCATTAATTGCTGGGCGAGGGGACACACTGACTGTTATAATAACACTACATCAGCAACTCCTGGCTCCCCAACAGCCGGATCCCAGGCAGGAGAGAGTCAGTGGCAGATAGCCATTTTTTTTT
hide sequence
RefSeq Acc Id:
XM_017601530 ⟹ XP_017457019
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 21,050,149 - 21,055,201 (-) NCBI mRatBN7.2 20 21,051,270 - 21,056,322 (-) NCBI Rnor_6.0 20 22,452,170 - 22,459,564 (-) NCBI
Sequence:
GCTCCAGCAGCTCTTCTGCTCCATTCTCTCTACCCTAACCCCTACCCTCAAGTTACCTAAAATA
hide sequence
RefSeq Acc Id:
NP_446085 ⟸ NM_053633
- UniProtKB:
Q54AG4 (UniProtKB/Swiss-Prot), P51774 (UniProtKB/Swiss-Prot), A6JKW1 (UniProtKB/TrEMBL), A6JKW0 (UniProtKB/TrEMBL)
- Sequence:
MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAAPSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPA
hide sequence
RefSeq Acc Id:
XP_017457019 ⟸ XM_017601530
- Peptide Label:
isoform X1
- UniProtKB:
A6JKW2 (UniProtKB/TrEMBL), Q9QYG4 (UniProtKB/TrEMBL)
- Sequence:
MNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCT
hide sequence
Ensembl Acc Id:
ENSRNOP00000000792 ⟸ ENSRNOT00000000792
RGD ID: 13701562 Promoter ID: EPDNEW_R12085 Type: single initiation site Name: Egr2_1 Description: early growth response 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 22,458,762 - 22,458,822 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Egr2
early growth response 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Egr2
early growth response 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA expression in the hippocampus increases in response to neural activity
728620
