Gng12 (G protein subunit gamma 12)

Gene: Gng12 (G protein subunit gamma 12) Rattus norvegicus

Analyze

Symbol:

Gng12

Name:

G protein subunit gamma 12

RGD ID:

621516

Description:

Enables phosphate ion binding activity. Involved in cerebral cortex development and response to lipopolysaccharide. Colocalizes with actin filament. Orthologous to human GNG12 (G protein subunit gamma 12); PARTICIPATES IN adenosine signaling pathway; dopamine signaling pathway via D1 family of receptors; follicle-stimulating hormone signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2,2-tetramine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide binding protein 12; guanine nucleotide binding protein gamma 12 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; heterotrimeric guanine nucleotide-binding protein 3a; Hg3a

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG12 (G protein subunit gamma 12)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Gng12 (guanine nucleotide binding protein (G protein), gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gng12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gng12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNG12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng12 (G protein subunit gamma 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RSPRY1 (ring finger and SPRY domain containing 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GNG12 (G protein subunit gamma 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gng12 (guanine nucleotide binding protein (G protein), gamma 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng12a (guanine nucleotide binding protein (G protein), gamma 12a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG43324	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	gng12b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gng12	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Gng12^{Tn(sb-T2/Bart3)2.320Mcwi}

Genetic Models:

F344-Gng12^{Tn(sb-T2/Bart3)2.320Mcwi}

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	97,340,830 - 97,464,422 (+)	NCBI		GRCr8
mRatBN7.2	4	96,011,118 - 96,134,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,010,952 - 96,134,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	101,285,782 - 101,380,771 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,060,751 - 97,155,744 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	95,485,792 - 95,580,682 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	97,634,925 - 97,763,478 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	97,657,671 - 97,760,102 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	162,420,268 - 162,549,350 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	96,622,363 - 96,624,479 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	96,866,867 - 96,868,580 (+)	NCBI
Celera	4	90,733,078 - 90,828,214 (+)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-adrenaline (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

butyric acid (ISO)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

Clofop (ISO)

cobalt dichloride (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

cyclophosphamide (ISO)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

dioxygen (EXP)

dorsomorphin (ISO)

ethanol (ISO)

fenamidone (ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

geldanamycin (ISO)

gentamycin (EXP)

GW 7647 (EXP,ISO)

ivermectin (ISO)

lead diacetate (ISO)

lead(0) (ISO)

leflunomide (EXP)

methapyrilene (ISO)

metronidazole (EXP)

neomycin (EXP)

paracetamol (ISO)

pentane (ISO)

perfluorooctane-1-sulfonic acid (ISO)

progesterone (ISO)

SB 431542 (ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

titanium dioxide (ISO)

torcetrapib (ISO)

trichostatin A (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cerebral cortex development (IEP)

G protein-coupled receptor signaling pathway (IBA)

response to lipopolysaccharide (IEP)

Cellular Component

actin filament (IDA)

heterotrimeric G-protein complex (IBA)

synapse (ISO)

Molecular Function

G-protein beta-subunit binding (IBA)

PDZ domain binding (ISO)

phosphate ion binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenosine signaling pathway (ISO)

chemokine mediated signaling pathway (IEA)

dopamine signaling pathway via D1 family of receptors (ISO)

follicle-stimulating hormone signaling pathway (ISO)

glutamate signaling pathway (IEA)

histamine signaling pathway, immunological (ISO)

luteinizing hormone signaling pathway (ISO)

melanocortin system pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

prostaglandin D2 signaling pathway (ISO)

prostaglandin I2 signaling pathway (ISO)

serotonin signaling pathway via receptors engaging G alphas protein family (ISO)

vasopressin signaling pathway via receptor type 2 (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	GTP-binding protein gamma12 subunit phosphorylation by protein kinase C--identification of the phosphorylation site and factors involved in cultured cells and rat tissues in vivo.	Asano T, etal., Eur J Biochem. 1998 Jan 15;251(1-2):314-9.
2.	Distribution of heterotrimeric G-protein beta and gamma subunits in the rat brain.	Betty M, etal., Neuroscience 1998 Jul;85(2):475-86.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Gng12 is a novel negative regulator of LPS-induced inflammation in the microglial cell line BV-2.	Larson KC, etal., Inflamm Res. 2009 Jul 1.
5.	Differential localization of the gamma 3 and gamma 12 subunits of G proteins in the mammalian brain.	Morishita R, etal., J Neurochem. 1997 Feb;68(2):820-7.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:19056867	PMID:23209302	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Gng12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	97,340,830 - 97,464,422 (+)	NCBI		GRCr8
mRatBN7.2	4	96,011,118 - 96,134,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,010,952 - 96,134,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	101,285,782 - 101,380,771 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,060,751 - 97,155,744 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	95,485,792 - 95,580,682 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	97,634,925 - 97,763,478 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	97,657,671 - 97,760,102 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	162,420,268 - 162,549,350 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	96,622,363 - 96,624,479 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	96,866,867 - 96,868,580 (+)	NCBI
Celera	4	90,733,078 - 90,828,214 (+)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

GNG12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	67,701,475 - 67,833,467 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	67,701,475 - 67,833,467 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	68,167,158 - 68,299,150 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	67,939,737 - 68,071,730 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	67,879,242 - 68,011,129	NCBI
Celera	1	66,458,012 - 66,589,844 (-)	NCBI		Celera
Cytogenetic Map	1	p31.3	NCBI
HuRef	1	66,277,405 - 66,409,293 (-)	NCBI		HuRef
CHM1_1	1	68,281,656 - 68,413,579 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	67,578,994 - 67,710,912 (-)	NCBI		T2T-CHM13v2.0

Gng12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	66,873,381 - 66,998,345 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	66,873,381 - 66,998,334 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	66,896,397 - 67,021,361 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	66,896,397 - 67,021,350 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	66,846,391 - 66,971,355 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	66,826,034 - 66,950,872 (+)	NCBI		MGSCv36	mm8
Celera	6	69,009,110 - 69,142,819 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	30.68	NCBI

Gng12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	23,634,402 - 23,644,600 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	23,576,515 - 23,644,600 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNG12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	159,037,990 - 159,167,844 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	158,197,602 - 158,327,585 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	66,941,315 - 67,071,442 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	68,897,289 - 69,025,742 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	68,901,264 - 68,903,487 (-)	Ensembl	panpan1.1		panPan2

GNG12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	77,316,649 - 77,378,356 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	77,338,685 - 77,374,937 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	79,907,731 - 79,987,868 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	77,972,445 - 77,978,233 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	6	77,452,925 - 77,558,595 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	77,346,730 - 77,427,239 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	77,832,739 - 77,913,898 (+)	NCBI		UU_Cfam_GSD_1.0

Gng12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	80,506,244 - 80,674,824 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936591	3,977,507 - 3,980,065 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936591	3,860,668 - 3,983,305 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	144,782,503 - 144,918,549 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	144,782,478 - 144,918,556 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	115,141,133 - 115,141,412 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNG12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	65,280,816 - 65,409,685 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	65,403,471 - 65,405,699 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	52,202,558 - 52,331,733 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	27,700,538 - 27,718,555 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	27,652,114 - 27,721,668 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gng12
248 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	26
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000075400
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78885890	102684881	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
2317587	Eae26	Experimental allergic encephalomyelitis QTL 26			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	88656681	103194984	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat

Markers in Region

D4Rat41

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	96,130,123 - 96,130,297 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	97,758,884 - 97,759,057	NCBI	Rnor6.0
Rnor_5.0	4	162,544,759 - 162,544,932	UniSTS	Rnor5.0
RGSC_v3.4	4	96,623,259 - 96,623,433	RGD	RGSC3.4
RGSC_v3.4	4	96,623,260 - 96,623,433	UniSTS	RGSC3.4
RGSC_v3.1	4	96,867,740 - 96,867,914	RGD
Celera	4	90,826,995 - 90,827,168	UniSTS
SHRSP x BN Map	4	48.75	RGD
SHRSP x BN Map	4	48.75	UniSTS
Cytogenetic Map	4	q31	UniSTS

BM384455

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	96,080,323 - 96,080,506 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	97,701,161 - 97,701,343	NCBI	Rnor6.0
Rnor_5.0	4	162,486,856 - 162,487,038	UniSTS	Rnor5.0
RGSC_v3.4	4	96,571,682 - 96,571,864	UniSTS	RGSC3.4
Celera	4	90,777,599 - 90,777,781	UniSTS
RH 3.4 Map	4	588.6	UniSTS
Cytogenetic Map	4	q31	UniSTS

AI842738

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	96,131,377 - 96,131,478 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	97,760,138 - 97,760,238	NCBI	Rnor6.0
Rnor_5.0	4	162,546,013 - 162,546,113	UniSTS	Rnor5.0
RGSC_v3.4	4	96,624,514 - 96,624,614	UniSTS	RGSC3.4
Celera	4	90,828,249 - 90,828,349	UniSTS
Cytogenetic Map	4	q31	UniSTS

Genetic Models

This gene Gng12 is modified in the following models/strains:

F344-Gng12^{Tn(sb-T2/Bart3)2.320Mcwi}

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	57	41	19	41	1	2	72	35	37	11	1
Low		8					7	9	2		4		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF022091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG378509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM031435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000075400 ⟹ ENSRNOP00000067190

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	96,011,154 - 96,131,341 (+)	Ensembl
Rnor_6.0 Ensembl	4	97,657,671 - 97,760,102 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109450 ⟹ ENSRNOP00000084739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	96,010,952 - 96,134,712 (+)	Ensembl

RefSeq Acc Id:

NM_053661 ⟹ NP_446113

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,365,961 - 97,461,053 (+)	NCBI
mRatBN7.2	4	96,036,246 - 96,131,343 (+)	NCBI
Rnor_6.0	4	97,657,671 - 97,760,103 (+)	NCBI
Rnor_5.0	4	162,420,268 - 162,549,350 (+)	NCBI
Celera	4	90,733,078 - 90,828,214 (+)	NCBI

Sequence:

show sequence

GTTCATATGGGAAGGACATTGGGGTGAGCATCTTCTCTATTTGCAGCTGGCTTTTCTGATTCAC
CCTACCATTTAAAACCTGGAGGCACTGGCCCACACAAAGCCTTGCTGATTTCAGGAAAGAAGAG
TCATCAAAGATGTCCAGCAAGACAGCGAGCACCAACAGCACAGCCCAAGCTAGGAGAACTGTGC
AGCAGCTGAGATTGGAAGCCTCCATCGAAAGAATAAAGGTCTCCAAAGCATCTGCAGACCTGAT
GTCATACTGTGAGGAGCATGCCCGGAGCGACCCTCTGCTGATGGGCATACCGACCTCAGAAAAC
CCATTCAAGGATAAGAAGACCTGCATCATCTTATAGTGGACCAGGAAGCACCCCTTGCCTCTCA
ATGCAAACCACAGCAGCAACCTGAAGAGATTCATGCAGCTTACCTGGTAACCACAGCTAGTAAC
TAAAACACCCTTCTCTTGGCATAACAGACCCTCAAGTCTCTCTCTTTCAAGTTGTCCTTTCTTC
GACCTTTACTGATTTAATACAGAATAACAATCTTATTTTCTATTTGGAAATATGGTATCATATT
GGGTTACTACTGTATAAGGAAAGTGGCAGGGGAGTTGTGGGAAGCTTGTCTTTACAATATACTA
TTGATTAAGATATGTCAAGACCTACATTGTCTAAGCACCGGCAAATTAAAATGTCAAGAATCGC
TTCAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039106904 ⟹ XP_038962832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,340,838 - 97,464,422 (+)	NCBI
mRatBN7.2	4	96,011,118 - 96,134,718 (+)	NCBI

RefSeq Acc Id:

XM_063285384 ⟹ XP_063141454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,340,830 - 97,464,422 (+)	NCBI

RefSeq Acc Id:

XM_063285385 ⟹ XP_063141455

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,340,859 - 97,464,422 (+)	NCBI

RefSeq Acc Id:

XM_063285386 ⟹ XP_063141456

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,456,109 - 97,464,422 (+)	NCBI

RefSeq Acc Id:

XM_063285387 ⟹ XP_063141457

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	97,341,332 - 97,464,422 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446113	(Get FASTA)	NCBI Sequence Viewer
	XP_038962832	(Get FASTA)	NCBI Sequence Viewer
	XP_063141454	(Get FASTA)	NCBI Sequence Viewer
	XP_063141455	(Get FASTA)	NCBI Sequence Viewer
	XP_063141456	(Get FASTA)	NCBI Sequence Viewer
	XP_063141457	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB82558	(Get FASTA)	NCBI Sequence Viewer
	AAZ23840	(Get FASTA)	NCBI Sequence Viewer
	AAZ23841	(Get FASTA)	NCBI Sequence Viewer
	CAG9553621	(Get FASTA)	NCBI Sequence Viewer
	EDL91583	(Get FASTA)	NCBI Sequence Viewer
	EDL91584	(Get FASTA)	NCBI Sequence Viewer
	EDL91585	(Get FASTA)	NCBI Sequence Viewer
	EDL91586	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067190
	ENSRNOP00000067190.1
	ENSRNOP00000084739.1

RefSeq Acc Id:	NP_446113 ⟸ NM_053661
- UniProtKB:	G3V6P8 (UniProtKB/TrEMBL), A6KF41 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSKTASTNSTAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFK DKKTCIIL hide sequence

RefSeq Acc Id:

ENSRNOP00000067190 ⟸ ENSRNOT00000075400

RefSeq Acc Id:	XP_038962832 ⟸ XM_039106904
- Peptide Label:	isoform X1
- UniProtKB:	G3V6P8 (UniProtKB/TrEMBL), A6KF41 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000084739 ⟸ ENSRNOT00000109450

RefSeq Acc Id:	XP_063141454 ⟸ XM_063285384
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063141455 ⟸ XM_063285385
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063141457 ⟸ XM_063285387
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063141456 ⟸ XM_063285386
- Peptide Label:	isoform X1

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6P8-F1-model_v2	AlphaFold	G3V6P8	1-72	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621516	AgrOrtholog
BioCyc Gene	G2FUF-44581	BioCyc
Ensembl Genes	ENSRNOG00000050231	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075400	ENTREZGENE
	ENSRNOT00000075400.3	UniProtKB/TrEMBL
	ENSRNOT00000109450.1	UniProtKB/TrEMBL
Gene3D-CATH	4.10.260.10	UniProtKB/TrEMBL
InterPro	G-protein_gamma-like_dom	UniProtKB/TrEMBL
	GGL_sf	UniProtKB/TrEMBL
	Gprotein-gamma	UniProtKB/TrEMBL
KEGG Report	rno:114120	UniProtKB/TrEMBL
NCBI Gene	114120	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(O) SUBUNIT GAMMA-12	UniProtKB/TrEMBL
	PTHR13809	UniProtKB/TrEMBL
Pfam	G-gamma	UniProtKB/TrEMBL
PhenoGen	Gng12	PhenoGen
PRINTS	GPROTEING	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_GAMMA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000050231	RatGTEx
SMART	G_gamma	UniProtKB/TrEMBL
	GGL	UniProtKB/TrEMBL
Superfamily-SCOP	G-protein_gamma-like	UniProtKB/TrEMBL
UniProt	A0A8I6GAY3_RAT	UniProtKB/TrEMBL
	A6KF41	ENTREZGENE, UniProtKB/TrEMBL
	G3V6P8	ENTREZGENE, UniProtKB/TrEMBL
	Q45QK0_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Gng12	guanine nucleotide binding protein (G protein), gamma 12		guanine nucleotide binding protein 12	Name updated	1299863	APPROVED
2002-08-07	Gng12	guanine nucleotide binding protein 12			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
null	expressed in white matter pathways

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)