Advanced Search (OLGA)

Gene: St13 (ST13, Hsp70 interacting protein) Rattus norvegicus

Analyze

Symbol:

St13 (Ensembl: Slc25a17)

Name:

ST13, Hsp70 interacting protein (Ensembl:solute carrier family 25 member 17)

RGD ID:

621312

Description:

Enables several functions, including Hsp70 protein binding activity; dATP binding activity; and unfolded protein binding activity. Involved in negative regulation of protein refolding and positive regulation of protein folding. Located in cytosol. Part of protein-containing complex. Orthologous to several human genes including ST13 (ST13 Hsp70 interacting protein); PARTICIPATES IN androgen signaling pathway; chaperone mediated autophagy pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hip; hsc70-interacting protein; protein ST13 homolog; suppression of tumorigenicity 13; suppression of tumorigenicity 13 (colon carcinoma) Hsp70-interacting protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ST13 (ST13 Hsp70 interacting protein)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	St13 (suppression of tumorigenicity 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	St13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ST13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ST13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	St13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ST13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ST13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	St13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	St13 (ST13 Hsp70 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC25A17 (solute carrier family 25 member 17)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, PhylomeDB, Treefam
Homo sapiens (human):	ST13P5 (ST13, Hsp70 interacting protein pseudogene 5)	HGNC	Inparanoid, Panther, PhylomeDB
Homo sapiens (human):	ST13P4 (ST13, Hsp70 interacting protein pseudogene 4)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	ST13 (ST13 Hsp70 interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ST13 (ST13 Hsp70 interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	St13 (suppression of tumorigenicity 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ST13P4 (ST13, Hsp70 interacting protein pseudogene 4)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Homo sapiens (human):	ST13P4 (ST13, Hsp70 interacting protein pseudogene 4)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Homo sapiens (human):	ST13P5 (ST13, Hsp70 interacting protein pseudogene 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ST13P5 (ST13, Hsp70 interacting protein pseudogene 5)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	st13 (ST13 Hsp70 interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hip-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hip-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	HIP	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	HIP-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	st13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Eau6

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,769,758 - 114,805,877 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	114,769,759 - 114,805,941 (-)	Ensembl				GRCr8
mRatBN7.2	7	112,891,007 - 112,925,727 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,844,375 - 112,925,945 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	114,653,298 - 114,688,067 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,876,850 - 116,911,568 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,846,210 - 116,880,977 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,585,770 - 122,635,731 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,585,771 - 122,635,731 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	122,561,392 - 122,612,277 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	119,694,123 - 119,728,936 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	109,210,016 - 109,245,175 (-)	NCBI		Celera
RGSC_v3.1	7	119,728,353 - 119,763,166 (-)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-methoxyethanol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

acrylamide (ISO)

actinomycin D (ISO)

albendazole (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amiodarone (EXP)

amitriptyline (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

butanal (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

carbamazepine (EXP)

carbon nanotube (ISO)

casticin (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (EXP)

chromium(6+) (ISO)

clomipramine (EXP)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclophosphamide (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

disodium selenite (ISO)

doxorubicin (ISO)

elemental selenium (EXP)

enzyme inhibitor (ISO)

ethanol (EXP,ISO)

felbamate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (EXP)

gabapentin (EXP)

gamma-linolenic acid (ISO)

gentamycin (EXP)

imipramine (EXP)

ivermectin (ISO)

ketoconazole (EXP)

kojic acid (EXP)

L-methionine (EXP)

lead diacetate (ISO)

methamphetamine (EXP)

methidathion (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

Nutlin-3 (ISO)

ochratoxin A (ISO)

ozone (ISO)

paracetamol (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

phenytoin (EXP)

quercetin (ISO)

resveratrol (ISO)

SCH 23390 (EXP)

selenium atom (EXP)

sodium arsenite (ISO)

Soman (EXP)

temozolomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

vitamin E (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of protein refolding (IDA)

positive regulation of protein folding (IDA)

protein folding (IBA)

response to bacterium (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IDA,ISO)

protein-containing complex (IDA)

Molecular Function

dATP binding (IDA)

Hsp70 protein binding (IBA,IDA,IPI)

identical protein binding (IDA,IPI)

protein binding (IPI,ISO)

protein dimerization activity (IEA)

protein domain specific binding (IDA,IPI)

protein-containing complex binding (IDA)

protein-folding chaperone binding (IPI)

unfolded protein binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

androgen signaling pathway (ISO)

chaperone mediated autophagy pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization of the molecular-chaperone function of the heat-shock-cognate-70-interacting protein.	Bruce BD and Churchich J, Eur J Biochem. 1997 May 1;245(3):738-44.
2.	The carboxy-terminal domain of Hsc70 provides binding sites for a distinct set of chaperone cofactors.	Demand J, etal., Mol Cell Biol 1998 Apr;18(4):2023-8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Hip, a novel cochaperone involved in the eukaryotic Hsc70/Hsp40 reaction cycle.	Hohfeld J, etal., Cell 1995 Nov 17;83(4):589-98.
6.	Characterization of functional domains of the eukaryotic co-chaperone Hip.	Irmer H and Hohfeld J, J Biol Chem. 1997 Jan 24;272(4):2230-5.
7.	Structure and function of Hip, an attenuator of the Hsp70 chaperone cycle.	Li Z, etal., Nat Struct Mol Biol. 2013 Aug;20(8):929-35. doi: 10.1038/nsmb.2608. Epub 2013 Jun 30.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Molecular chaperones throughout the life cycle of the androgen receptor.	Prescott J and Coetzee GA, Cancer Lett. 2006 Jan 8;231(1):12-9.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Chaperone mediated autophagy to the rescue: A new-fangled target for the treatment of neurodegenerative diseases.	Xilouri M and Stefanis L, Mol Cell Neurosci. 2015 May;66(Pt A):29-36. doi: 10.1016/j.mcn.2015.01.003. Epub 2015 Feb 25.
14.	C terminus of Hsc70-interacting protein (CHIP)-mediated degradation of hippocampal estrogen receptor-alpha and the critical period hypothesis of estrogen neuroprotection.	Zhang QG, etal., Proc Natl Acad Sci U S A. 2011 Aug 30;108(35):E617-24. doi: 10.1073/pnas.1104391108. Epub 2011 Aug 1.

Additional References at PubMed

PMID:15489334	PMID:17013759	PMID:19056867	PMID:19875982	PMID:20458337	PMID:23012479	PMID:23376485	PMID:28131823

Genomics

Comparative Map Data

St13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,769,758 - 114,805,877 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	114,769,759 - 114,805,941 (-)	Ensembl				GRCr8
mRatBN7.2	7	112,891,007 - 112,925,727 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,844,375 - 112,925,945 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	114,653,298 - 114,688,067 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,876,850 - 116,911,568 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,846,210 - 116,880,977 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,585,770 - 122,635,731 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,585,771 - 122,635,731 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	122,561,392 - 122,612,277 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	119,694,123 - 119,728,936 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	109,210,016 - 109,245,175 (-)	NCBI		Celera
RGSC_v3.1	7	119,728,353 - 119,763,166 (-)	NCBI
Cytogenetic Map	7	q34	NCBI

ST13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	40,824,535 - 40,856,639 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	40,824,535 - 40,856,690 (-)	Ensembl			hg38	GRCh38
GRCh37	22	41,220,539 - 41,252,643 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	39,550,545 - 39,582,633 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	39,545,102 - 39,577,187	NCBI
Celera	22	25,024,269 - 25,056,358 (-)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	24,182,572 - 24,215,046 (-)	NCBI		HuRef
CHM1_1	22	41,179,290 - 41,211,764 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	41,296,730 - 41,328,831 (-)	NCBI		T2T-CHM13v2.0

St13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	81,247,869 - 81,284,278 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	81,247,870 - 81,284,278 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	81,365,044 - 81,399,694 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	81,363,669 - 81,400,077 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	81,195,474 - 81,230,124 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	81,192,299 - 81,226,949 (-)	NCBI		MGSCv36	mm8
Celera	15	83,483,114 - 83,517,731 (-)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	38.07	NCBI

St13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	26,476,469 - 26,507,671 (-)	Ensembl
ChiLan1.0	NW_004955413	26,478,579 - 26,507,671 (-)	NCBI	ChiLan1.0	ChiLan1.0

ST13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	50,656,928 - 50,687,437 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	53,355,816 - 53,387,712 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	21,719,713 - 21,751,912 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	39,815,337 - 39,848,049 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	39,815,337 - 39,848,049 (-)	Ensembl			panPan2	panpan1.1

ST13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	24,379,997 - 24,411,764 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	24,379,997 - 24,411,766 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	24,314,161 - 24,345,833 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	25,127,715 - 25,159,445 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	25,127,684 - 25,161,322 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	24,842,961 - 24,874,594 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	25,163,854 - 25,195,541 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	25,338,235 - 25,369,960 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

St13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	7,966,770 - 7,998,826 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	977,093 - 1,009,221 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	976,928 - 1,010,748 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ST13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	7,583,048 - 7,617,762 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	7,583,074 - 7,617,766 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	4,763,686 - 4,796,346 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ST13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	23,373,970 - 23,413,054 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	23,375,723 - 23,412,742 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	102,161,727 - 102,195,149 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

St13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	7,634,970 - 7,661,974 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	7,634,910 - 7,663,135 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

St13
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	251,115,651 - 251,152,261 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in St13
200 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	244
Count of miRNA genes:	153
Interacting mature miRNAs:	170
Transcripts:	ENSRNOT00000025925
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X82021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025758 ⟹ ENSRNOP00000025758

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,844,375 - 112,870,868 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000025925 ⟹ ENSRNOP00000025925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,844,814 - 112,925,774 (-)	Ensembl
Rnor_6.0 Ensembl	7	122,585,771 - 122,635,731 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107864 ⟹ ENSRNOP00000084383

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	114,769,759 - 114,805,941 (-)	Ensembl
mRatBN7.2 Ensembl	7	112,889,610 - 112,925,746 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109011 ⟹ ENSRNOP00000088770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,844,382 - 112,886,941 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117864 ⟹ ENSRNOP00000088669

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	114,769,759 - 114,799,634 (-)	Ensembl
mRatBN7.2 Ensembl	7	112,889,680 - 112,925,945 (-)	Ensembl

RefSeq Acc Id:

NM_031122 ⟹ NP_112384

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,771,156 - 114,805,877 (-)	NCBI
mRatBN7.2	7	112,891,007 - 112,925,727 (-)	NCBI
Rnor_6.0	7	122,585,770 - 122,635,731 (-)	NCBI
Rnor_5.0	7	122,561,392 - 122,612,277 (-)	NCBI
RGSC_v3.4	7	119,694,123 - 119,728,936 (-)	RGD
Celera	7	109,210,016 - 109,245,175 (-)	RGD

Sequence:

show sequence

GCGTCGACGGGCTTGGCATCGGGCCTCCGCAGCCGCCCACCGCCAGAAGCTTCCAGCCTCACCA
CTATGGATCCCCGCAAAGTGAGCGAGCTTCGGGCCTTCGTGAAGATGTGTAGGCAGGACCCGAG
CGTCCTGCACACCGAGGAAATGCGTTTCCTGAGGGAGTGGGTGGAGAGCATGGGGGGTAAAGTA
CCACCTGCTACTCATAAAGCGAAGTCAGAAGAAAACACTAAGGAAGAAAAAAGAGACAAGACGA
CAGAGGACAACATAAAGACAGAGGAGCCATCGAGTGAGGAGAGCGATCTAGAAATTGACAATGA
AGGTGTAATTGAAGCAGACACTGATGCTCCTCAGGAAATGGGAGATGAAAATGCAGAGATAACT
GAGGCGATGATGGATGAAGCAAATGAAAAGAAGGGGGCTGCCATCGACGCTCTAAATGATGGTG
AGCTCCAGAAAGCCATTGACTTGTTCACAGACGCCATCAAGCTAAACCCTCGCTTGGCCATTCT
GTATGCCAAGAGAGCCAGTGTTTTCGTCAAATTACAGAAGCCAAATGCTGCCATCCGAGACTGT
GACAGAGCTATTGAAATAAACCCTGATTCAGCTCAGCCATACAAATGGAGAGGGAAAGCGCACA
GACTCCTGGGTCACTGGGAAGAAGCAGCTCGCGATCTTGCCCTGGCCTGTAAATTGGACTATGA
TGAGGACGCCAGTGCAATGCTGAGAGAAGTCCAGCCTCGGGCTCAAAAAATTGCTGAACATCGG
AGAAAGTATGAGCGAAAACGTGAAGAGCGAGAGATAAAAGAACGAATAGAAAGGGTGAAGAAGG
CTCGAGAAGAGCATGAAAAAGCCCAAAGGGAAGAAGAAGCCAGAAGACAATCTGGATCTCAGTT
TGGCTCTTTTCCAGGTGGTTTTCCTGGGGGAATGCCTGGTAATTTTCCTGGAGGAATGCCTGGA
ATGGGAGGGGCCATGCCAGGAATGGCAGGAATGCCTGGACTCAACGAAATCCTCAGTGACCCAG
AGGTTCTTGCAGCCATGCAGGATCCAGAAGTCATGGTGGCTTTCCAGGATGTGGCCCAGAACCC
ATCAAATATGTCAAAATATCAGAACAACCCAAAGGTTATGAATCTCATCAGTAAATTGTCAGCC
AAGTTTGGAGGTCACTCATAATGTCAAAGCCCTTGCTGAATGAAGAACAGCTTAGCTCACTTAC
TGGATGTTGCAATAATACAAACCAGTGTACCTCTGACCTCACCAGAGAGCTGGGGCGCTTCGAA
GATAATCCCTACCCTCTGCATCATATGCGGCTGAGGCATATTACAGTGGTTTGCCATTAGAGTG
TTCATTCAGATAATGTTTTCCTATTAGGAATTACAAACTTAAAACATTTTTCAACCTTAAACAT
ATTTTTTAAAAATTTAGGGGATGTCAATTCCTACATTTTTCGTTACTAATCTTTTTGGGTTTTT
CCTTTTGAATTACTGGGCAAGGAAGGTGAATGTGGATGATTTACTGCTTTCATGAATGAAATAA
AGATTTGTTAGTGGGAAGCAAATAAAACACATTTAAGTTGATTGAGTCGGACATACGGTTACTG
CAACATCTTGAATTGTCTTTAATGTTTTACTTCACAATGATCTATTTCAGTAAATCTTTTGGGA
CCACCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063264299 ⟹ XP_063120369

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,769,758 - 114,799,749 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112384	(Get FASTA)	NCBI Sequence Viewer
	XP_063120369	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78804	(Get FASTA)	NCBI Sequence Viewer
	CAA57546	(Get FASTA)	NCBI Sequence Viewer
	EDM15726	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000084383
	ENSRNOP00000088669
GenBank Protein	P50503	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112384 ⟸ NM_031122

- UniProtKB:

P50503 (UniProtKB/Swiss-Prot), A6HSZ6 (UniProtKB/TrEMBL), A0A8I5ZYX0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKRDKTT
EDNIKTEEPSSEESDLEIDNEGVIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGE
LQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHR
LLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKIAEHRRKYERKREEREIKERIERVKKA
REEHEKAQREEEARRQSGSQFGSFPGGFPGGMPGNFPGGMPGMGGAMPGMAGMPGLNEILSDPE
VLAAMQDPEVMVAFQDVAQNPSNMSKYQNNPKVMNLISKLSAKFGGHS

hide sequence

Ensembl Acc Id:

ENSRNOP00000025925 ⟸ ENSRNOT00000025925

Ensembl Acc Id:

ENSRNOP00000088770 ⟸ ENSRNOT00000109011

Ensembl Acc Id:

ENSRNOP00000088669 ⟸ ENSRNOT00000117864

Ensembl Acc Id:

ENSRNOP00000025758 ⟸ ENSRNOT00000025758

Ensembl Acc Id:

ENSRNOP00000084383 ⟸ ENSRNOT00000107864

RefSeq Acc Id:	XP_063120369 ⟸ XM_063264299
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A6M6 (UniProtKB/TrEMBL), A0A8I5ZYX0 (UniProtKB/TrEMBL)

Protein Domains

STI1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50503-F1-model_v2	AlphaFold	P50503	1-368	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695508

Promoter ID:

EPDNEW_R6033

Type:

initiation region

Name:

St13_1

Description:

ST13, Hsp70 interacting protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	122,635,694 - 122,635,754	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621312	AgrOrtholog
BioCyc Gene	G2FUF-32680	BioCyc
Ensembl Genes	ENSRNOG00000018920	Ensembl, ENTREZGENE
	ENSRNOG00000019070	Ensembl
Ensembl Transcript	ENSRNOT00000107864	ENTREZGENE
	ENSRNOT00000117864	ENTREZGENE
Gene3D-CATH	1.10.260.100	UniProtKB/Swiss-Prot
	1.25.40.10	UniProtKB/Swiss-Prot
	6.10.250.3420	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7109473	IMAGE-MGC_LOAD
InterPro	Hip_N	UniProtKB/Swiss-Prot
	STI1	UniProtKB/Swiss-Prot
	STI1_HS-bd	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
	TPR_repeat	UniProtKB/Swiss-Prot
KEGG Report	rno:81800	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93379	IMAGE-MGC_LOAD
NCBI Gene	81800	ENTREZGENE
PANTHER	HSC70-INTERACTING PROTEIN	UniProtKB/Swiss-Prot
	HSC70-INTERACTING PROTEIN	UniProtKB/Swiss-Prot
Pfam	HipN	UniProtKB/Swiss-Prot
	STI1	UniProtKB/Swiss-Prot
	TPR_8	UniProtKB/Swiss-Prot
PhenoGen	St13	PhenoGen
PROSITE	TPR	UniProtKB/Swiss-Prot
	TPR_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018920	RatGTEx
	ENSRNOG00000019070	RatGTEx
SMART	STI1	UniProtKB/Swiss-Prot
	TPR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZYX0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6M6	ENTREZGENE, UniProtKB/TrEMBL
	A6HSZ6	ENTREZGENE, UniProtKB/TrEMBL
	F10A1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-21	St13	ST13, Hsp70 interacting protein	St13	suppression of tumorigenicity 13	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	St13	suppression of tumorigenicity 13		suppression of tumorigenicity 13 (colon carcinoma) Hsp70-interacting protein	Name updated	1299863	APPROVED
2002-08-07	St13	suppression of tumorigenicity 13 (colon carcinoma) Hsp70-interacting protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains tetratricopeptide repeats	729993
gene_function	binds the ATPase domains of at least two Hsc70 molecules	729993

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations