Symbol:
Mtarc2 (Ensembl: Marc2)
Name:
mitochondrial amidoxime reducing component 2
RGD ID:
621257
Description:
Predicted to enable molybdenum ion binding activity; molybdopterin cofactor binding activity; and oxidoreductase activity, acting on other nitrogenous compounds as donors. Predicted to be involved in cellular detoxification of nitrogen compound; nitrate metabolic process; and nitric oxide biosynthetic process. Predicted to be located in mitochondrion. Orthologous to human MTARC2 (mitochondrial amidoxime reducing component 2); INTERACTS WITH (+)-schisandrin B; 1,2,4-trimethylbenzene; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC364084; mARC1; Marc2; Mg87; moco sulfurase C-terminal domain-containing protein 2; MOCO sulphurase C-terminal domain containing 2; molybdenum cofactor sulfurase C-terminal domain-containing protein 2; MOSC domain-containing protein 2; MOSC domain-containing protein 2, mitochondrial; Mosc2; similar to MOCO sulphurase C-terminal domain containing 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 98,894,347 - 98,928,754 (-) NCBI GRCr8 mRatBN7.2 13 96,362,810 - 96,397,284 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 13 98,871,474 - 98,903,474 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 100,270,651 - 100,302,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 97,453,707 - 97,485,716 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 102,724,266 - 102,755,511 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 102,724,348 - 102,756,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 107,401,548 - 107,432,904 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 100,809,306 - 100,838,648 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 100,998,348 - 101,027,691 NCBI Celera 13 95,883,189 - 95,914,342 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mtarc2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MTARC2 mRNA] CTD PMID:31150632 Mtarc2 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of MTARC2 protein CTD PMID:17337753 Mtarc2 Rat 1,2-dimethylhydrazine decreases expression ISO Mtarc2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MTARC2 mRNA CTD PMID:22206623 Mtarc2 Rat 17beta-estradiol decreases expression ISO Mtarc2 (Mus musculus) 6480464 Estradiol results in decreased expression of MTARC2 mRNA CTD PMID:39298647 Mtarc2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MTARC2 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Mtarc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MTARC2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MTARC2 mRNA CTD PMID:20106945 and PMID:21632981 Mtarc2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MTARC2 mRNA CTD PMID:21346803 Mtarc2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of MTARC2 protein CTD PMID:34915118 Mtarc2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MTARC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of MTARC2 mRNA CTD PMID:28628672 Mtarc2 Rat 4,4'-sulfonyldiphenol increases expression ISO MTARC2 (Homo sapiens) 6480464 bisphenol S results in increased expression of MTARC2 mRNA CTD PMID:27685785 Mtarc2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Mtarc2 (Mus musculus) 6480464 bisphenol S results in decreased expression of MTARC2 mRNA CTD PMID:39298647 Mtarc2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of MTARC2 mRNA CTD PMID:28628672 Mtarc2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MTARC2 mRNA CTD PMID:24780913 Mtarc2 Rat aflatoxin B1 decreases expression ISO MTARC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MTARC2 mRNA CTD PMID:22100608 Mtarc2 Rat aflatoxin B1 decreases methylation ISO MTARC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MTARC2 gene CTD PMID:27153756 Mtarc2 Rat all-trans-retinoic acid decreases expression ISO MTARC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MTARC2 mRNA CTD PMID:33167477 Mtarc2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MTARC2 mRNA CTD PMID:16483693 Mtarc2 Rat arsenous acid increases expression ISO Mtarc2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MTARC2 mRNA CTD PMID:35676786 Mtarc2 Rat benzamidoxime multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [CYB5B protein co-treated with CYB5R3 protein co-treated with MTARC2 protein] results in increased reduction of benzamidoxime CTD PMID:22924387 Mtarc2 Rat benzo[a]pyrene increases methylation ISO MTARC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MTARC2 promoter CTD PMID:27901495 Mtarc2 Rat benzo[a]pyrene decreases expression ISO MTARC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MTARC2 mRNA CTD PMID:32234424 Mtarc2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MTARC2 mRNA CTD PMID:25181051 Mtarc2 Rat bisphenol A increases expression ISO MTARC2 (Homo sapiens) 6480464 bisphenol A results in increased expression of MTARC2 protein CTD PMID:34186270 Mtarc2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MTARC2 mRNA CTD PMID:34947998 Mtarc2 Rat bisphenol AF increases expression ISO MTARC2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MTARC2 protein CTD PMID:34186270 Mtarc2 Rat Bisphenol B increases expression ISO MTARC2 (Homo sapiens) 6480464 bisphenol B results in increased expression of MTARC2 protein CTD PMID:34186270 Mtarc2 Rat bisphenol F multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MTARC2 mRNA CTD PMID:28628672 Mtarc2 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of MTARC2 mRNA CTD PMID:24136188 Mtarc2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MTARC2 promoter CTD PMID:22457795 Mtarc2 Rat cadmium dichloride decreases expression ISO MTARC2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MTARC2 mRNA CTD PMID:38568856 Mtarc2 Rat cadmium dichloride increases expression ISO Mtarc2 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of MTARC2 mRNA CTD PMID:24982889 Mtarc2 Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of MTARC2 promoter CTD PMID:22457795 Mtarc2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of MTARC2 promoter CTD PMID:22457795 Mtarc2 Rat carbon nanotube decreases expression ISO Mtarc2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MTARC2 mRNA CTD PMID:25554681 Mtarc2 Rat CGP 52608 multiple interactions ISO MTARC2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MTARC2 gene] CTD PMID:28238834 Mtarc2 Rat clofibrate decreases expression ISO Mtarc2 (Mus musculus) 6480464 Clofibrate results in decreased expression of MTARC2 mRNA CTD PMID:17585979 Mtarc2 Rat copper atom multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MTARC2 mRNA CTD PMID:20971185 Mtarc2 Rat copper(0) multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MTARC2 mRNA CTD PMID:20971185 Mtarc2 Rat corosolic acid decreases expression ISO MTARC2 (Homo sapiens) 6480464 corosolic acid results in decreased expression of MTARC2 mRNA CTD PMID:37939859 Mtarc2 Rat cyclosporin A decreases expression ISO MTARC2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MTARC2 mRNA CTD PMID:20106945 and PMID:25562108 Mtarc2 Rat dexamethasone multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MTARC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of MTARC2 mRNA CTD PMID:28628672 Mtarc2 Rat diarsenic trioxide increases expression ISO Mtarc2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MTARC2 mRNA CTD PMID:35676786 Mtarc2 Rat dorsomorphin multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mtarc2 Rat entinostat increases expression ISO MTARC2 (Homo sapiens) 6480464 entinostat results in increased expression of MTARC2 mRNA CTD PMID:26272509 Mtarc2 Rat entinostat multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MTARC2 mRNA CTD PMID:27188386 Mtarc2 Rat epoxiconazole increases expression ISO Mtarc2 (Mus musculus) 6480464 epoxiconazole results in increased expression of MTARC2 mRNA CTD PMID:35436446 Mtarc2 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of MTARC2 mRNA CTD PMID:18035473 Mtarc2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MTARC2 mRNA CTD PMID:24136188 Mtarc2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of MTARC2 mRNA CTD PMID:24136188 Mtarc2 Rat Heptachlor epoxide decreases expression ISO Mtarc2 (Mus musculus) 6480464 Heptachlor Epoxide results in decreased expression of MTARC2 mRNA CTD PMID:25270620 Mtarc2 Rat hypochlorous acid decreases expression ISO Mtarc2 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of MTARC2 mRNA CTD PMID:19376150 Mtarc2 Rat indometacin multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MTARC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of MTARC2 mRNA CTD PMID:28628672 Mtarc2 Rat methamphetamine affects response to substance ISO MTARC2 (Homo sapiens) 6480464 MTARC2 gene SNP affects the susceptibility to Methamphetamine CTD PMID:18316681 Mtarc2 Rat N(4)-hydroxycytidine multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [CYB5B protein co-treated with CYB5R3 protein co-treated with MTARC2 protein] results in increased reduction of N(4)-hydroxycytidine CTD PMID:22924387 Mtarc2 Rat NAD zwitterion multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [MTARC2 protein co-treated with CYB5B protein co-treated with CYB5R3 protein co-treated with NAD] results in increased reduction of sulfamethoxazole hydroxylamine CTD PMID:25170804 Mtarc2 Rat NAD(+) multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [MTARC2 protein co-treated with CYB5B protein co-treated with CYB5R3 protein co-treated with NAD] results in increased reduction of sulfamethoxazole hydroxylamine CTD PMID:25170804 Mtarc2 Rat nickel atom decreases expression ISO MTARC2 (Homo sapiens) 6480464 Nickel results in decreased expression of MTARC2 mRNA CTD PMID:24768652 and PMID:25583101 Mtarc2 Rat nickel sulfate increases expression ISO MTARC2 (Homo sapiens) 6480464 nickel sulfate results in increased expression of MTARC2 mRNA CTD PMID:22714537 Mtarc2 Rat nitrates multiple interactions ISO Mtarc2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MTARC2 mRNA CTD PMID:35964746 Mtarc2 Rat panobinostat increases expression ISO MTARC2 (Homo sapiens) 6480464 Panobinostat results in increased expression of MTARC2 mRNA CTD PMID:26272509 Mtarc2 Rat panobinostat multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MTARC2 mRNA CTD PMID:27188386 Mtarc2 Rat paracetamol increases expression ISO MTARC2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MTARC2 mRNA CTD PMID:25704631 Mtarc2 Rat paracetamol affects expression ISO Mtarc2 (Mus musculus) 6480464 Acetaminophen affects the expression of MTARC2 mRNA CTD PMID:17562736 Mtarc2 Rat perfluorooctanoic acid decreases expression ISO MTARC2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of MTARC2 mRNA CTD PMID:23146750 Mtarc2 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of MTARC2 mRNA CTD PMID:19162173 Mtarc2 Rat pirinixic acid decreases expression ISO Mtarc2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MTARC2 mRNA CTD PMID:20813756 Mtarc2 Rat SB 431542 multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mtarc2 Rat sulfamethoxazole hydroxylamine multiple interactions ISO MTARC2 (Homo sapiens) 6480464 [MTARC2 protein co-treated with CYB5B protein co-treated with CYB5R3 protein co-treated with NAD] results in increased reduction of sulfamethoxazole hydroxylamine CTD PMID:25170804 Mtarc2 Rat testosterone decreases expression ISO MTARC2 (Homo sapiens) 6480464 Testosterone results in decreased expression of MTARC2 mRNA CTD PMID:33359661 Mtarc2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MTARC2 mRNA CTD PMID:31150632 Mtarc2 Rat tetrachloromethane decreases expression ISO Mtarc2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MTARC2 mRNA CTD PMID:31919559 Mtarc2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MTARC2 mRNA] CTD PMID:31150632 Mtarc2 Rat thapsigargin increases expression ISO MTARC2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of MTARC2 mRNA CTD PMID:22378314 Mtarc2 Rat thimerosal decreases expression ISO MTARC2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of MTARC2 mRNA CTD PMID:27188386 Mtarc2 Rat titanium dioxide increases methylation ISO Mtarc2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of MTARC2 gene CTD PMID:35295148 Mtarc2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MTARC2 mRNA CTD PMID:19448997 Mtarc2 Rat triptonide increases expression ISO Mtarc2 (Mus musculus) 6480464 triptonide results in increased expression of MTARC2 mRNA CTD PMID:33045310 Mtarc2 Rat tunicamycin increases expression ISO MTARC2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of MTARC2 mRNA CTD PMID:22378314 Mtarc2 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of MTARC2 protein CTD PMID:17337753 Mtarc2 Rat valproic acid increases expression ISO MTARC2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MTARC2 mRNA CTD PMID:19101580 Mtarc2 Rat valproic acid increases expression ISO Mtarc2 (Mus musculus) 6480464 Valproic Acid results in increased expression of MTARC2 mRNA CTD PMID:20546886 and PMID:21427059 Mtarc2 Rat valproic acid affects expression ISO Mtarc2 (Mus musculus) 6480464 Valproic Acid affects the expression of MTARC2 mRNA CTD PMID:17292431 Mtarc2 Rat valproic acid affects expression ISO MTARC2 (Homo sapiens) 6480464 Valproic Acid affects the expression of MTARC2 mRNA CTD PMID:25979313 Mtarc2 Rat zearalenone increases expression ISO Mtarc2 (Mus musculus) 6480464 Zearalenone results in increased expression of MTARC2 protein CTD PMID:25058043 Mtarc2 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of MTARC2 mRNA CTD PMID:12672911 Mtarc2 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of MTARC2 mRNA CTD PMID:12672911
(+)-schisandrin B (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenous acid (ISO) benzamidoxime (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dorsomorphin (ISO) entinostat (ISO) epoxiconazole (ISO) flavonoids (EXP) flutamide (EXP) glafenine (EXP) Heptachlor epoxide (ISO) hypochlorous acid (ISO) indometacin (ISO) methamphetamine (ISO) N(4)-hydroxycytidine (ISO) NAD zwitterion (ISO) NAD(+) (ISO) nickel atom (ISO) nickel sulfate (ISO) nitrates (ISO) panobinostat (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) pirinixic acid (ISO) SB 431542 (ISO) sulfamethoxazole hydroxylamine (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thimerosal (ISO) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) tunicamycin (ISO) undecane (EXP) valproic acid (ISO) zearalenone (ISO) zinc atom (EXP) zinc(0) (EXP)
Mtarc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 98,894,347 - 98,928,754 (-) NCBI GRCr8 mRatBN7.2 13 96,362,810 - 96,397,284 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 13 98,871,474 - 98,903,474 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 100,270,651 - 100,302,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 97,453,707 - 97,485,716 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 102,724,266 - 102,755,511 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 102,724,348 - 102,756,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 107,401,548 - 107,432,904 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 100,809,306 - 100,838,648 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 100,998,348 - 101,027,691 NCBI Celera 13 95,883,189 - 95,914,342 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
MTARC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 220,748,322 - 220,784,815 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 220,748,225 - 220,784,815 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 220,921,664 - 220,958,157 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 218,988,299 - 219,024,222 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 194,141,035 - 194,176,957 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 191,596,292 - 191,632,216 (+) NCBI HuRef CHM1_1 1 222,194,135 - 222,230,058 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 219,988,028 - 220,024,522 (+) NCBI T2T-CHM13v2.0
Mtarc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 184,545,263 - 184,579,266 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 184,545,265 - 184,578,648 (-) Ensembl GRCm39 Ensembl GRCm38 1 184,813,066 - 184,846,451 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 184,813,068 - 184,846,451 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 186,636,947 - 186,669,726 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 186,513,856 - 186,546,635 (-) NCBI MGSCv36 mm8 Celera 1 191,775,533 - 191,808,292 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.12 NCBI
MTARC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 28,615,340 - 28,654,642 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 28,577,172 - 28,616,492 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 196,333,803 - 196,371,147 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 201,368,306 - 201,405,602 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 201,369,424 - 201,405,602 (+) Ensembl panpan1.1 panPan2
MTARC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 15,426,884 - 15,451,701 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 15,426,666 - 15,451,136 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 15,457,261 - 15,493,511 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 15,451,758 - 15,487,926 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 15,451,494 - 15,522,862 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 15,459,348 - 15,495,474 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 15,813,447 - 15,849,915 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 16,106,377 - 16,142,896 (+) NCBI UU_Cfam_GSD_1.0
Mtarc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 56,258,120 - 56,295,420 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936650 1,506,329 - 1,543,712 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936650 1,506,471 - 1,543,532 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MTARC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 10,156,728 - 10,189,924 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 10,156,732 - 10,194,371 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 12,363,633 - 12,387,601 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MTARC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 8,745,754 - 8,782,967 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 8,748,605 - 8,782,379 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 9,029,599 - 9,066,624 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mtarc2
.
Predicted Target Of
Count of predictions: 199 Count of miRNA genes: 147 Interacting mature miRNAs: 161 Transcripts: ENSRNOT00000029439 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
D13Got253
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 13 107,402,993 - 107,403,129 NCBI Rnor5.0 RGSC_v3.4 13 100,810,458 - 100,810,593 UniSTS RGSC3.4 Cytogenetic Map 13 q26 UniSTS
AU048082
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 96,397,941 - 96,398,167 (+) MAPPER mRatBN7.2 Rnor_6.0 13 102,756,184 - 102,756,409 NCBI Rnor6.0 Rnor_5.0 13 107,433,628 - 107,433,853 UniSTS Rnor5.0 RGSC_v3.4 13 100,839,372 - 100,839,597 UniSTS RGSC3.4 Celera 13 95,915,065 - 95,915,290 UniSTS Cytogenetic Map 13 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029439 ⟹ ENSRNOP00000034963
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 96,339,757 - 96,397,796 (-) Ensembl Rnor_6.0 Ensembl 13 102,724,348 - 102,756,174 (-) Ensembl
RefSeq Acc Id:
NM_134410 ⟹ NP_599237
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 98,897,101 - 98,928,754 (-) NCBI mRatBN7.2 13 96,365,564 - 96,397,218 (-) NCBI Rnor_6.0 13 102,724,266 - 102,755,460 (-) NCBI Rnor_5.0 13 107,401,548 - 107,432,904 (-) NCBI RGSC_v3.4 13 100,809,306 - 100,838,648 (-) RGD Celera 13 95,883,189 - 95,914,342 (-) RGD
Sequence:
GGTTAGTTTAACATGGGTTCCTCCAGCTCCACCGCTCTGGCTCGCCTTGGACTCCCCGGGCAGCCGCGGTCCACCTGGCTCGGCGTCGCCGCGCTGGGACTGGCCGCAGTGGCGCTGGGGACCGTGGC
hide sequence
RefSeq Acc Id:
XM_017598658 ⟹ XP_017454147
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 98,894,347 - 98,928,742 (-) NCBI mRatBN7.2 13 96,362,810 - 96,397,284 (-) NCBI Rnor_6.0 13 102,728,231 - 102,755,511 (-) NCBI
Sequence:
GAACCTTAAGCCTCGCCCCGTCCCCGCGGCCTGGTAGCCCAGGCCTGCCCCGGTTAGTTTAACA
hide sequence
RefSeq Acc Id:
XR_010056899
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 98,904,183 - 98,910,832 (-) NCBI
RefSeq Acc Id:
NP_599237 ⟸ NM_134410
- Peptide Label:
precursor
- UniProtKB:
O88994 (UniProtKB/Swiss-Prot), A6JGP7 (UniProtKB/TrEMBL)
- Sequence:
MGSSSSTALARLGLPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRQLQQVGTVSKVWIYPIKSCKGVSVCETECTDMGLRCGKVRDRFWMVVKEDGHMITARQEPRLVLVTITLENNYLMLEAP
hide sequence
RefSeq Acc Id:
XP_017454147 ⟸ XM_017598658
- Peptide Label:
isoform X1
- Sequence:
MGSSSSTALARLGLPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRQLQQVGTVSKVWIYPIKSCKGVSVCETECTDMGLRCGKVRDRFWMVVKEDGHMITARQEPRLVLVTITLENNYLMLEAP
hide sequence
Ensembl Acc Id:
ENSRNOP00000034963 ⟸ ENSRNOT00000029439
RGD ID: 13699087 Promoter ID: EPDNEW_R9611 Type: multiple initiation site Name: Marc2_1 Description: mitochondrial amidoxime reducing component 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 102,755,476 - 102,755,536 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-10-10
Mtarc2
mitochondrial amidoxime reducing component 2
Marc2
mitochondrial amidoxime reducing component 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-04-17
Marc2
mitochondrial amidoxime reducing component 2
LOC364084
similar to MOCO sulphurase C-terminal domain containing 2
Data merged from RGD:1598297
737654 PROVISIONAL
2011-12-06
Marc2
mitochondrial amidoxime reducing component 2
Mosc2
MOCO sulphurase C-terminal domain containing 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC364084
similar to MOCO sulphurase C-terminal domain containing 2
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Mosc2
MOCO sulphurase C-terminal domain containing 2
Mg87
Mg87 protein
Symbol and Name updated
1299863 APPROVED
2005-01-20
Mg87
Mg87 protein
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Mg87
Mg87 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
