Symbol:
Ogg1
Name:
8-oxoguanine DNA glycosylase
RGD ID:
621168
Description:
Enables damaged DNA binding activity and oxidized purine nucleobase lesion DNA N-glycosylase activity. Involved in several processes, including base-excision repair; cellular response to cadmium ion; and response to estradiol. Predicted to be located in mitochondrion; nuclear matrix; and nuclear speck. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Biomarker of hepatitis; middle cerebral artery infarction; renal cell carcinoma; status epilepticus; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in several diseases, including Graves' disease; artery disease (multiple); carcinoma (multiple); eye disease (multiple); and reproductive organ cancer (multiple). Orthologous to human OGG1 (8-oxoguanine DNA glycosylase); PARTICIPATES IN base excision repair pathway; INTERACTS WITH (+)-pilocarpine; 1,2-dimethylhydrazine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
8-oxoguanine DNA-glycosylase 1; 8-oxoguanine-DNA-glycosylase; N-glycosylase/DNA lyase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 148,030,237 - 148,037,599 (+) NCBI GRCr8 mRatBN7.2 4 146,474,701 - 146,481,959 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 146,474,750 - 146,484,766 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 151,859,153 - 151,865,412 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 147,639,996 - 147,646,255 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 146,261,532 - 146,267,801 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 145,282,828 - 145,289,367 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 145,282,797 - 145,289,326 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 208,580,193 - 208,586,457 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 149,209,745 - 149,219,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 149,454,585 - 149,463,922 (+) NCBI Celera 4 135,032,266 - 135,038,520 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ogg1 Rat (+)-dexrazoxane increases expression ISO Ogg1 (Mus musculus) 6480464 Dexrazoxane results in increased expression of OGG1 mRNA CTD PMID:28973540 Ogg1 Rat (+)-dexrazoxane multiple interactions ISO Ogg1 (Mus musculus) 6480464 Dexrazoxane inhibits the reaction [Idarubicin results in decreased expression of OGG1 mRNA] and Dexrazoxane inhibits the reaction [Idarubicin results in decreased expression of OGG1 protein] CTD PMID:28973540 Ogg1 Rat (+)-pilocarpine decreases expression EXP 6480464 Pilocarpine results in decreased expression of OGG1 mRNA and Pilocarpine results in decreased expression of OGG1 protein CTD PMID:20206232 Ogg1 Rat (S)-nicotine multiple interactions ISO OGG1 (Homo sapiens) 6480464 OGG1 gene SNP affects the susceptibility to [Pesticides co-treated with Nicotine] CTD PMID:29747151 Ogg1 Rat 1,1'-azobis(N,N-dimethylformamide) multiple interactions ISO OGG1 (Homo sapiens) 6480464 Diamide results in increased oxidation of and results in decreased activity of OGG1 protein CTD PMID:16923968 Ogg1 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of OGG1 mRNA CTD PMID:32387197 Ogg1 Rat 1,4-benzoquinone decreases expression ISO Ogg1 (Mus musculus) 6480464 quinone results in decreased expression of OGG1 mRNA CTD PMID:26456483 Ogg1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of OGG1 mRNA and Estradiol results in decreased expression of OGG1 protein CTD PMID:24894866 Ogg1 Rat 17beta-estradiol affects expression ISO OGG1 (Homo sapiens) 6480464 Estradiol affects the expression of OGG1 mRNA CTD PMID:22082530 Ogg1 Rat 17beta-estradiol multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Estradiol results in increased expression of OGG1 mRNA] which results in increased susceptibility to Cisplatin more ... CTD PMID:22082530 and PMID:28323900 Ogg1 Rat 17beta-estradiol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of OGG1 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of OGG1 protein] CTD PMID:24894866 Ogg1 Rat 1H-pyrazole increases expression ISO Ogg1 (Mus musculus) 6480464 pyrazole results in increased expression of OGG1 mRNA CTD PMID:17945193 Ogg1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ogg1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of OGG1 mRNA CTD PMID:21354282 Ogg1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of OGG1 mRNA CTD PMID:21346803 Ogg1 Rat 2,6-diamino-5-formamido-4-hydroxypyrimidine affects metabolic processing ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the metabolism of 2 and 6-diamino-4-hydroxy-5-formamidopyrimidine CTD PMID:20067321 Ogg1 Rat 2-aminobiphenyl decreases expression ISO OGG1 (Homo sapiens) 6480464 2-aminodiphenyl results in decreased expression of OGG1 mRNA and 2-aminodiphenyl results in decreased expression of OGG1 protein CTD PMID:16112689 Ogg1 Rat 3,4-methylenedioxymethamphetamine increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 gene mutant form results in increased susceptibility to N-Methyl-3 and 4-methylenedioxyamphetamine CTD PMID:26629949 Ogg1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO OGG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of OGG1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of OGG1 mRNA CTD PMID:28628672 Ogg1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO OGG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of OGG1 mRNA CTD PMID:28628672 Ogg1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO OGG1 (Homo sapiens) 6480464 Decitabine affects the reaction [Estradiol affects the expression of OGG1 mRNA] more ... CTD PMID:22082530 and PMID:22112500 Ogg1 Rat 5-aza-2'-deoxycytidine increases expression ISO OGG1 (Homo sapiens) 6480464 Decitabine results in increased expression of OGG1 mRNA CTD PMID:22082530 Ogg1 Rat 5-azacytidine decreases expression ISO Ogg1 (Mus musculus) 6480464 Azacitidine results in decreased expression of OGG1 protein CTD PMID:22064374 Ogg1 Rat 5-azacytidine decreases methylation ISO Ogg1 (Mus musculus) 6480464 Azacitidine results in decreased methylation of OGG1 promoter CTD PMID:22064374 Ogg1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of OGG1 mRNA CTD PMID:24780913 Ogg1 Rat 7,12-dimethyltetraphene increases expression ISO OGG1 (Homo sapiens) 6480464 9 more ... CTD PMID:25697376 Ogg1 Rat 7,12-dimethyltetraphene multiple interactions ISO OGG1 (Homo sapiens) 6480464 Metformin inhibits the reaction [9 more ... CTD PMID:25697376 Ogg1 Rat 7,8-dihydro-8-oxoguanine decreases abundance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in decreased abundance of 7 more ... CTD PMID:21873502 and PMID:21925250 Ogg1 Rat 7,8-dihydro-8-oxoguanine multiple interactions ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the reaction [Methamphetamine results in increased abundance of 7 and 8-dihydro-8-oxoguanine] CTD PMID:18768699 Ogg1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO Ogg1 (Mus musculus) 6480464 NLRP3 gene mutant form inhibits the reaction [Uric Acid results in decreased expression of OGG1 mRNA] CTD PMID:23619996 Ogg1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione decreases expression ISO Ogg1 (Mus musculus) 6480464 Uric Acid results in decreased expression of OGG1 mRNA CTD PMID:23619996 Ogg1 Rat 8-hydroxy-2'-deoxyguanosine increases cleavage ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in increased cleavage of 8-Hydroxy-2'-Deoxyguanosine CTD PMID:19193190 Ogg1 Rat 8-hydroxy-2'-deoxyguanosine multiple interactions ISO OGG1 (Homo sapiens) 6480464 thymidine glycol inhibits the reaction [OGG1 protein results in increased cleavage of 8-Hydroxy-2'-Deoxyguanosine] and thymidine glycol promotes the reaction [OGG1 protein results in increased cleavage of 8-Hydroxy-2'-Deoxyguanosine] CTD PMID:19193190 Ogg1 Rat acrolein affects response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the susceptibility to Acrolein CTD PMID:17003489 Ogg1 Rat acrolein multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of OGG1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of OGG1 mRNA CTD PMID:32699268 Ogg1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of OGG1 mRNA CTD PMID:28959563 Ogg1 Rat acrylamide decreases expression ISO OGG1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of OGG1 mRNA CTD PMID:32763439 Ogg1 Rat aflatoxin B1 increases expression ISO Ogg1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of OGG1 protein CTD PMID:24675474 Ogg1 Rat all-trans-retinoic acid increases expression ISO OGG1 (Homo sapiens) 6480464 Tretinoin results in increased expression of OGG1 mRNA CTD PMID:15498508 Ogg1 Rat alpha-hexachlorocyclohexane multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with alpha-hexachlorocyclohexane] results in increased expression of OGG1 mRNA CTD PMID:16246485 Ogg1 Rat alpha-pinene multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of OGG1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of OGG1 mRNA CTD PMID:32699268 Ogg1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of OGG1 mRNA CTD PMID:16483693 Ogg1 Rat aniline increases expression EXP 6480464 aniline results in increased expression of OGG1 CTD PMID:21145906 and PMID:23352893 Ogg1 Rat antirheumatic drug increases expression ISO OGG1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of OGG1 mRNA CTD PMID:24449571 Ogg1 Rat aristolochic acid A decreases expression ISO OGG1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of OGG1 mRNA CTD PMID:33212167 Ogg1 Rat Aroclor 1254 decreases expression ISO Ogg1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of OGG1 mRNA CTD PMID:25113976 Ogg1 Rat arsane increases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic results in increased expression of OGG1 mRNA and Arsenic results in increased expression of OGG1 protein CTD PMID:16759981 and PMID:21332098 Ogg1 Rat arsane multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OGG1 mRNA CTD PMID:31542844 Ogg1 Rat arsane decreases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic results in decreased expression of OGG1 mRNA and Arsenic results in decreased expression of OGG1 protein CTD PMID:20478284 more ... Ogg1 Rat arsane multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Selenium co-treated with Arsenic] results in increased expression of OGG1 protein more ... CTD PMID:20478284 more ... Ogg1 Rat arsane increases expression ISO Ogg1 (Mus musculus) 6480464 Arsenic results in increased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat arsane affects expression ISO OGG1 (Homo sapiens) 6480464 Arsenic affects the expression of OGG1 CTD PMID:21235219 Ogg1 Rat arsenic atom increases expression ISO Ogg1 (Mus musculus) 6480464 Arsenic results in increased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat arsenic atom multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OGG1 mRNA CTD PMID:31542844 Ogg1 Rat arsenic atom multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Selenium co-treated with Arsenic] results in increased expression of OGG1 protein more ... CTD PMID:20478284 more ... Ogg1 Rat arsenic atom increases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic results in increased expression of OGG1 mRNA and Arsenic results in increased expression of OGG1 protein CTD PMID:16759981 and PMID:21332098 Ogg1 Rat arsenic atom decreases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic results in decreased expression of OGG1 mRNA and Arsenic results in decreased expression of OGG1 protein CTD PMID:20478284 more ... Ogg1 Rat arsenic atom affects expression ISO OGG1 (Homo sapiens) 6480464 Arsenic affects the expression of OGG1 CTD PMID:21235219 Ogg1 Rat arsenite(3-) increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 gene mutant form results in increased susceptibility to arsenite CTD PMID:24190502 Ogg1 Rat arsenous acid decreases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of OGG1 mRNA CTD PMID:20458559 Ogg1 Rat arsenous acid affects activity ISO OGG1 (Homo sapiens) 6480464 OGG1 protein affects the activity of Arsenic Trioxide CTD PMID:17101720 Ogg1 Rat aurintricarboxylic acid decreases activity ISO OGG1 (Homo sapiens) 6480464 Aurintricarboxylic Acid results in decreased activity of OGG1 protein CTD PMID:26218629 Ogg1 Rat belinostat decreases expression ISO Ogg1 (Mus musculus) 6480464 belinostat results in decreased expression of OGG1 mRNA and belinostat results in decreased expression of OGG1 protein CTD PMID:29733868 Ogg1 Rat benzene increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 gene SNP results in increased susceptibility to Benzene CTD PMID:16600130 Ogg1 Rat benzo[a]pyrene increases expression ISO Ogg1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of OGG1 mRNA CTD PMID:29145655 Ogg1 Rat benzo[a]pyrene increases methylation ISO OGG1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of OGG1 promoter CTD PMID:27901495 Ogg1 Rat benzo[a]pyrene decreases expression ISO OGG1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of OGG1 mRNA CTD PMID:26238291 Ogg1 Rat benzo[a]pyrene decreases expression ISO Ogg1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of OGG1 protein CTD PMID:29145655 Ogg1 Rat beryllium dichloride affects expression ISO Ogg1 (Mus musculus) 6480464 beryllium chloride affects the expression of OGG1 mRNA CTD PMID:23793613 Ogg1 Rat bezafibrate increases expression ISO Ogg1 (Mus musculus) 6480464 Bezafibrate results in increased expression of OGG1 mRNA CTD PMID:15447978 Ogg1 Rat biphenyl-4-amine decreases expression ISO OGG1 (Homo sapiens) 6480464 4-biphenylamine results in decreased expression of OGG1 mRNA and 4-biphenylamine results in decreased expression of OGG1 protein CTD PMID:16112689 and PMID:33847444 Ogg1 Rat biphenyl-4-amine multiple interactions ISO OGG1 (Homo sapiens) 6480464 Propolis inhibits the reaction [4-biphenylamine results in decreased expression of OGG1 protein] CTD PMID:33847444 Ogg1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OGG1 mRNA CTD PMID:25181051 Ogg1 Rat bisphenol A increases methylation ISO OGG1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of OGG1 promoter CTD PMID:36572933 Ogg1 Rat bisphenol A decreases expression ISO OGG1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of OGG1 mRNA CTD PMID:36633214 Ogg1 Rat bisphenol A multiple interactions ISO Ogg1 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of OGG1 mRNA] CTD PMID:36633214 Ogg1 Rat bisphenol A decreases expression ISO Ogg1 (Mus musculus) 6480464 bisphenol A results in decreased expression of OGG1 mRNA CTD PMID:36633214 Ogg1 Rat bisphenol A multiple interactions ISO OGG1 (Homo sapiens) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of OGG1 mRNA] CTD PMID:36633214 Ogg1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of OGG1 mRNA CTD PMID:31129395 Ogg1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OGG1 mRNA CTD PMID:30816183 more ... Ogg1 Rat bisphenol F multiple interactions ISO OGG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of OGG1 mRNA CTD PMID:28628672 Ogg1 Rat bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of OGG1 protein CTD PMID:37837293 Ogg1 Rat bleomycin A2 increases expression ISO Ogg1 (Mus musculus) 6480464 Bleomycin results in increased expression of OGG1 protein CTD PMID:35654123 Ogg1 Rat bleomycin A2 multiple interactions ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the reaction [Bleomycin results in decreased expression of CDH1 protein] more ... CTD PMID:35654123 Ogg1 Rat bleomycin A2 affects response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the susceptibility to Bleomycin CTD PMID:35654123 Ogg1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of OGG1 mRNA CTD PMID:19479010 Ogg1 Rat cadmium atom multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Cadmium inhibits the reaction [SP1 protein binds to OGG1 promoter]] which results in decreased expression of OGG1 mRNA more ... CTD PMID:15760895 and PMID:16923968 Ogg1 Rat cadmium atom affects activity ISO OGG1 (Homo sapiens) 6480464 Cadmium affects the activity of OGG1 protein CTD PMID:21605570 Ogg1 Rat cadmium atom decreases expression ISO OGG1 (Homo sapiens) 6480464 Cadmium results in decreased expression of OGG1 mRNA and Cadmium results in decreased expression of OGG1 protein CTD PMID:15760895 Ogg1 Rat cadmium dichloride multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Cadmium Chloride co-treated with titanium dioxide] results in increased expression of OGG1 mRNA more ... CTD PMID:21671166 and PMID:22112500 Ogg1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of OGG1 mRNA CTD PMID:30606898 Ogg1 Rat cadmium dichloride decreases expression ISO OGG1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of OGG1 mRNA and Cadmium Chloride results in decreased expression of OGG1 protein CTD PMID:22112500 and PMID:26472689 Ogg1 Rat cadmium dichloride increases methylation ISO OGG1 (Homo sapiens) 6480464 Cadmium Chloride results in increased methylation of OGG1 promoter CTD PMID:22112500 Ogg1 Rat camphene multiple interactions EXP 6480464 [camphene co-treated with geraniol] inhibits the reaction [nimesulide results in increased expression of OGG1 protein] CTD PMID:22509279 Ogg1 Rat carbon atom increases expression ISO Ogg1 (Mus musculus) 6480464 Carbon analog results in increased expression of OGG1 mRNA CTD PMID:24792328 Ogg1 Rat carbon atom multiple interactions ISO Ogg1 (Mus musculus) 6480464 NCF1 gene mutant form inhibits the reaction [Carbon analog results in increased expression of OGG1 mRNA] CTD PMID:24792328 Ogg1 Rat carmustine decreases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in decreased susceptibility to Carmustine CTD PMID:11181913 and PMID:11741815 Ogg1 Rat CGP 52608 multiple interactions ISO OGG1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to OGG1 gene] CTD PMID:28238834 Ogg1 Rat chlorpyrifos decreases expression ISO OGG1 (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of OGG1 mRNA CTD PMID:28887667 Ogg1 Rat chlorpyrifos affects activity ISO OGG1 (Homo sapiens) 6480464 Chlorpyrifos affects the activity of OGG1 protein CTD PMID:29359425 Ogg1 Rat chlorpyrifos increases expression ISO OGG1 (Homo sapiens) 6480464 Chlorpyrifos results in increased expression of OGG1 mRNA and Chlorpyrifos results in increased expression of OGG1 protein CTD PMID:29359425 Ogg1 Rat chlorpyrifos affects expression ISO OGG1 (Homo sapiens) 6480464 Chlorpyrifos affects the expression of OGG1 protein CTD PMID:28887667 Ogg1 Rat chromium atom decreases expression ISO OGG1 (Homo sapiens) 6480464 Chromium results in decreased expression of OGG1 mRNA CTD PMID:30496737 Ogg1 Rat chromium(6+) affects expression ISO OGG1 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of OGG1 mRNA and chromium hexavalent ion affects the expression of OGG1 protein CTD PMID:23050433 Ogg1 Rat chromium(6+) decreases expression ISO OGG1 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of OGG1 mRNA CTD PMID:30496737 Ogg1 Rat cisplatin multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Estradiol results in increased expression of OGG1 mRNA] which results in increased susceptibility to Cisplatin CTD PMID:28323900 Ogg1 Rat cobalt dichloride decreases expression ISO OGG1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of OGG1 mRNA CTD PMID:19320972 Ogg1 Rat crocidolite asbestos increases expression ISO OGG1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of OGG1 mRNA CTD PMID:11181447 Ogg1 Rat crocidolite asbestos multiple interactions ISO Ogg1 (Mus musculus) 6480464 OGG1 protein mutant form promotes the reaction [Asbestos more ... CTD PMID:24918270 Ogg1 Rat crocidolite asbestos increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 protein mutant form results in increased susceptibility to Asbestos and Crocidolite CTD PMID:24918270 Ogg1 Rat curcumin multiple interactions ISO OGG1 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Arsenic results in increased expression of OGG1 mRNA] and Curcumin inhibits the reaction [Arsenic results in increased expression of OGG1 protein] CTD PMID:21332098 Ogg1 Rat cyclophosphamide decreases expression ISO Ogg1 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of OGG1 protein CTD PMID:27032448 Ogg1 Rat DDT multiple interactions EXP 6480464 [DDT co-treated with Diethylnitrosamine] results in decreased expression of OGG1 mRNA and [DDT co-treated with Diethylnitrosamine] results in increased expression of OGG1 mRNA CTD PMID:15885732 Ogg1 Rat DDT increases expression EXP 6480464 DDT results in increased expression of OGG1 mRNA CTD PMID:11948501 Ogg1 Rat deoxynivalenol increases expression ISO OGG1 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of OGG1 mRNA and deoxynivalenol results in increased expression of OGG1 protein CTD PMID:24355168 Ogg1 Rat dexamethasone multiple interactions ISO OGG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of OGG1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of OGG1 mRNA CTD PMID:28628672 Ogg1 Rat Diacetoxyscirpenol decreases expression ISO Ogg1 (Mus musculus) 6480464 diacetoxyscirpenol results in decreased expression of OGG1 mRNA CTD PMID:31836554 Ogg1 Rat diarsenic trioxide decreases expression ISO OGG1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of OGG1 mRNA CTD PMID:20458559 Ogg1 Rat diarsenic trioxide affects activity ISO OGG1 (Homo sapiens) 6480464 OGG1 protein affects the activity of Arsenic Trioxide CTD PMID:17101720 Ogg1 Rat Dibutyl phosphate affects expression ISO OGG1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of OGG1 mRNA CTD PMID:37042841 Ogg1 Rat dibutyl phthalate increases expression ISO OGG1 (Homo sapiens) 6480464 Dibutyl Phthalate results in increased expression of OGG1 mRNA CTD PMID:33120273 Ogg1 Rat dicyclanil multiple interactions ISO Ogg1 (Mus musculus) 6480464 [dicyclanil co-treated with Diethylnitrosamine] results in increased expression of OGG1 mRNA CTD PMID:20118626 Ogg1 Rat diethyl maleate multiple interactions ISO Ogg1 (Mus musculus) 6480464 [diethyl maleate results in decreased abundance of Glutathione] which results in increased expression of OGG1 mRNA CTD PMID:22564015 Ogg1 Rat dimethylarsinic acid multiple interactions ISO Ogg1 (Mus musculus) 6480464 OGG1 protein inhibits the reaction [Cacodylic Acid results in decreased expression of HSPA1B mRNA] more ... CTD PMID:17441966 Ogg1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of OGG1 mRNA CTD PMID:17481689 Ogg1 Rat dioxygen decreases expression ISO OGG1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of OGG1 protein CTD PMID:25030372 Ogg1 Rat dorsomorphin multiple interactions ISO OGG1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OGG1 mRNA CTD PMID:27188386 Ogg1 Rat doxorubicin multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Estradiol results in increased expression of OGG1 mRNA] which results in increased susceptibility to Doxorubicin CTD PMID:28323900 Ogg1 Rat doxorubicin decreases expression ISO OGG1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of OGG1 mRNA CTD PMID:36634904 Ogg1 Rat elemental carbon increases expression ISO Ogg1 (Mus musculus) 6480464 Carbon analog results in increased expression of OGG1 mRNA CTD PMID:24792328 Ogg1 Rat elemental carbon multiple interactions ISO Ogg1 (Mus musculus) 6480464 NCF1 gene mutant form inhibits the reaction [Carbon analog results in increased expression of OGG1 mRNA] CTD PMID:24792328 Ogg1 Rat elemental selenium multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Selenium co-treated with Arsenic] results in increased expression of OGG1 protein CTD PMID:20478284 Ogg1 Rat elemental selenium increases expression ISO OGG1 (Homo sapiens) 6480464 Selenium results in increased expression of OGG1 protein CTD PMID:20478284 Ogg1 Rat entinostat decreases expression ISO OGG1 (Homo sapiens) 6480464 entinostat results in decreased expression of OGG1 mRNA CTD PMID:26272509 Ogg1 Rat entinostat multiple interactions ISO OGG1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OGG1 mRNA CTD PMID:27188386 Ogg1 Rat ethanol increases expression ISO OGG1 (Homo sapiens) 6480464 Ethanol results in increased expression of OGG1 mRNA and Ethanol results in increased expression of OGG1 protein CTD PMID:22056336 Ogg1 Rat ethanol multiple interactions ISO Ogg1 (Mus musculus) 6480464 phenyl-N-tert-butylnitrone inhibits the reaction [OGG1 mutant form results in increased susceptibility to Ethanol] CTD PMID:25354798 Ogg1 Rat ethanol increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 mutant form results in increased susceptibility to Ethanol CTD PMID:25354798 Ogg1 Rat etoposide multiple interactions ISO Ogg1 (Mus musculus) 6480464 wogonin inhibits the reaction [Etoposide results in decreased expression of OGG1 mRNA] CTD PMID:23872129 Ogg1 Rat etoposide decreases expression ISO Ogg1 (Mus musculus) 6480464 Etoposide results in decreased expression of OGG1 mRNA CTD PMID:23872129 Ogg1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of OGG1 mRNA CTD PMID:24793618 Ogg1 Rat folic acid increases expression ISO OGG1 (Homo sapiens) 6480464 Folic Acid results in increased expression of OGG1 mRNA CTD PMID:36354958 Ogg1 Rat folic acid multiple interactions ISO OGG1 (Homo sapiens) 6480464 Folic Acid inhibits the reaction [Arsenic results in decreased expression of OGG1 mRNA] CTD PMID:35490796 Ogg1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of OGG1 mRNA CTD PMID:22507866 Ogg1 Rat Gentiopicrin increases expression ISO OGG1 (Homo sapiens) 6480464 gentiopicroside results in increased expression of OGG1 mRNA CTD PMID:38852899 Ogg1 Rat geraniol multiple interactions EXP 6480464 [camphene co-treated with geraniol] inhibits the reaction [nimesulide results in increased expression of OGG1 protein] CTD PMID:22509279 Ogg1 Rat glutathione multiple interactions ISO Ogg1 (Mus musculus) 6480464 [diethyl maleate results in decreased abundance of Glutathione] which results in increased expression of OGG1 mRNA CTD PMID:22564015 Ogg1 Rat glycine betaine multiple interactions ISO Ogg1 (Mus musculus) 6480464 Betaine inhibits the reaction [S-Adenosylhomocysteine results in decreased expression of OGG1 protein] and Betaine inhibits the reaction [S-Adenosylhomocysteine results in decreased methylation of OGG1 promoter] CTD PMID:22064374 Ogg1 Rat glyphosate decreases expression ISO OGG1 (Homo sapiens) 6480464 Glyphosate results in decreased expression of OGG1 mRNA CTD PMID:31295307 Ogg1 Rat glyphosate affects activity ISO OGG1 (Homo sapiens) 6480464 Glyphosate affects the activity of OGG1 protein CTD PMID:29359425 Ogg1 Rat glyphosate increases expression ISO OGG1 (Homo sapiens) 6480464 Glyphosate results in increased expression of OGG1 mRNA and Glyphosate results in increased expression of OGG1 protein CTD PMID:29359425 Ogg1 Rat gold atom multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of OGG1 mRNA CTD PMID:28433809 Ogg1 Rat gold(0) multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of OGG1 mRNA CTD PMID:28433809 Ogg1 Rat hydralazine multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of OGG1 mRNA CTD PMID:17183730 Ogg1 Rat hydrazine multiple interactions ISO Ogg1 (Mus musculus) 6480464 hydrazine inhibits the reaction [2-chloroethyl ethyl sulfide results in decreased expression of OGG1 mRNA] CTD PMID:32142722 Ogg1 Rat hydrazines decreases activity ISO OGG1 (Homo sapiens) 6480464 Hydrazines analog results in decreased activity of OGG1 protein CTD PMID:26218629 Ogg1 Rat hydrogen peroxide increases expression ISO OGG1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of OGG1 mRNA CTD PMID:19651184 Ogg1 Rat hydrogen peroxide increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 mutant form results in increased susceptibility to Hydrogen Peroxide and OGG1 protein results in increased susceptibility to Hydrogen Peroxide CTD PMID:25127756 and PMID:34196753 Ogg1 Rat hydrogen peroxide multiple interactions ISO OGG1 (Homo sapiens) 6480464 [NUDT1 mutant form results in increased susceptibility to Hydrogen Peroxide] which results in increased expression of OGG1 mRNA more ... CTD PMID:19651184 and PMID:25127756 Ogg1 Rat idarubicin decreases expression ISO Ogg1 (Mus musculus) 6480464 Idarubicin results in decreased expression of OGG1 mRNA and Idarubicin results in decreased expression of OGG1 protein CTD PMID:28973540 Ogg1 Rat idarubicin multiple interactions ISO Ogg1 (Mus musculus) 6480464 Dexrazoxane inhibits the reaction [Idarubicin results in decreased expression of OGG1 mRNA] and Dexrazoxane inhibits the reaction [Idarubicin results in decreased expression of OGG1 protein] CTD PMID:28973540 Ogg1 Rat imidacloprid increases expression EXP 6480464 imidacloprid results in increased expression of OGG1 mRNA CTD PMID:27914857 Ogg1 Rat indometacin multiple interactions ISO OGG1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of OGG1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of OGG1 mRNA CTD PMID:28628672 Ogg1 Rat L-ascorbic acid multiple interactions ISO OGG1 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [sodium arsenite results in decreased expression of OGG1 protein] and Ascorbic Acid inhibits the reaction [sodium arsenite results in increased methylation of OGG1 promoter] CTD PMID:33388378 Ogg1 Rat lead(0) decreases expression ISO Ogg1 (Mus musculus) 6480464 Lead results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat lead(0) affects response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 gene polymorphism affects the susceptibility to Lead CTD PMID:22466227 Ogg1 Rat lithium atom decreases expression ISO Ogg1 (Mus musculus) 6480464 Lithium results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat lithium hydride decreases expression ISO Ogg1 (Mus musculus) 6480464 Lithium results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat lupeol multiple interactions ISO OGG1 (Homo sapiens) 6480464 lupeol inhibits the reaction [mancozeb results in decreased expression of OGG1 mRNA] CTD PMID:27235710 Ogg1 Rat mancozeb decreases expression ISO OGG1 (Homo sapiens) 6480464 mancozeb results in decreased expression of OGG1 mRNA CTD PMID:27235710 Ogg1 Rat mancozeb multiple interactions ISO OGG1 (Homo sapiens) 6480464 lupeol inhibits the reaction [mancozeb results in decreased expression of OGG1 mRNA] CTD PMID:27235710 Ogg1 Rat manganese atom decreases expression ISO Ogg1 (Mus musculus) 6480464 Manganese results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat manganese(0) decreases expression ISO Ogg1 (Mus musculus) 6480464 Manganese results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat melatonin multiple interactions ISO OGG1 (Homo sapiens) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of OGG1 mRNA] CTD PMID:36633214 Ogg1 Rat melatonin multiple interactions ISO Ogg1 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of OGG1 mRNA] CTD PMID:36633214 Ogg1 Rat menadione increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein SNP results in increased susceptibility to Vitamin K 3 CTD PMID:17651912 Ogg1 Rat menadione increases expression ISO OGG1 (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of OGG1 mRNA CTD PMID:23410634 Ogg1 Rat mercury atom decreases expression ISO Ogg1 (Mus musculus) 6480464 Mercury results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat mercury(0) decreases expression ISO Ogg1 (Mus musculus) 6480464 Mercury results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat metformin multiple interactions ISO OGG1 (Homo sapiens) 6480464 Metformin inhibits the reaction [9 more ... CTD PMID:25697376 Ogg1 Rat methamphetamine multiple interactions ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the reaction [Methamphetamine results in increased abundance of 7 and 8-dihydro-8-oxoguanine] CTD PMID:18768699 Ogg1 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of OGG1 mRNA CTD PMID:19564919 Ogg1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of OGG1 mRNA CTD PMID:19564919 Ogg1 Rat methamphetamine affects response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the susceptibility to Methamphetamine CTD PMID:18768699 Ogg1 Rat methyl methanesulfonate increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in increased susceptibility to Methyl Methanesulfonate CTD PMID:34196753 Ogg1 Rat methyl tert-butyl ether increases expression EXP 6480464 methyl tert-butyl ether results in increased expression of OGG1 mRNA CTD PMID:19150650 Ogg1 Rat methylarsonic acid increases expression EXP 6480464 monomethylarsonic acid results in increased expression of OGG1 mRNA CTD PMID:17481689 Ogg1 Rat miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of OGG1 mRNA CTD PMID:22262564 Ogg1 Rat mitomycin C decreases expression ISO Ogg1 (Mus musculus) 6480464 Mitomycin results in decreased expression of OGG1 protein CTD PMID:27032448 Ogg1 Rat mono(2-ethylhexyl) phthalate increases expression ISO OGG1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of OGG1 mRNA CTD PMID:33120273 Ogg1 Rat monocrotophos decreases expression ISO OGG1 (Homo sapiens) 6480464 Monocrotophos results in decreased expression of OGG1 mRNA CTD PMID:28887667 Ogg1 Rat myristicin decreases expression ISO OGG1 (Homo sapiens) 6480464 myristicin results in decreased expression of OGG1 mRNA CTD PMID:24792648 Ogg1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO OGG1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [TH5487 inhibits the reaction [TGFB1 protein results in increased expression of OGG1 protein]] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [TGFB1 protein results in increased expression of OGG1 protein] CTD PMID:35654123 Ogg1 Rat N-nitrosodiethylamine multiple interactions ISO Ogg1 (Mus musculus) 6480464 [dicyclanil co-treated with Diethylnitrosamine] results in increased expression of OGG1 mRNA more ... CTD PMID:20101389 more ... Ogg1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [DDT co-treated with Diethylnitrosamine] results in decreased expression of OGG1 mRNA more ... CTD PMID:15885732 more ... Ogg1 Rat N-nitrosodimethylamine increases expression ISO OGG1 (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of OGG1 mRNA CTD PMID:19031421 Ogg1 Rat nickel atom decreases expression ISO Ogg1 (Mus musculus) 6480464 Nickel results in decreased expression of OGG1 mRNA CTD PMID:22641096 Ogg1 Rat nicotine multiple interactions ISO OGG1 (Homo sapiens) 6480464 OGG1 gene SNP affects the susceptibility to [Pesticides co-treated with Nicotine] CTD PMID:29747151 Ogg1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of OGG1 protein CTD PMID:22509279 Ogg1 Rat nimesulide multiple interactions EXP 6480464 [camphene co-treated with geraniol] inhibits the reaction [nimesulide results in increased expression of OGG1 protein] and Silymarin inhibits the reaction [nimesulide results in increased expression of OGG1 protein] CTD PMID:22509279 Ogg1 Rat O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of OGG1 mRNA CTD PMID:21659616 Ogg1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of OGG1 mRNA CTD PMID:23358140 Ogg1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of OGG1 mRNA CTD PMID:25729387 Ogg1 Rat oxirane increases expression EXP 6480464 Ethylene Oxide results in increased expression of OGG1 protein CTD PMID:16051529 Ogg1 Rat oxirane affects response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein affects the susceptibility to Ethylene Oxide CTD PMID:16386346 Ogg1 Rat ozone multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of OGG1 mRNA more ... CTD PMID:29767793 more ... Ogg1 Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Ozone]] which results in decreased methylation of OGG1 gene and [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Ozone]] which results in increased expression of OGG1 mRNA CTD PMID:36423397 Ogg1 Rat paclitaxel increases expression ISO OGG1 (Homo sapiens) 6480464 Paclitaxel results in increased expression of OGG1 protein CTD PMID:15907983 Ogg1 Rat paracetamol affects expression ISO Ogg1 (Mus musculus) 6480464 Acetaminophen affects the expression of OGG1 mRNA CTD PMID:17562736 Ogg1 Rat paracetamol increases expression ISO OGG1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of OGG1 mRNA CTD PMID:25704631 and PMID:29067470 Ogg1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of OGG1 mRNA CTD PMID:16751229 Ogg1 Rat paracetamol multiple interactions ISO Ogg1 (Mus musculus) 6480464 O(2)-vinyl-1-(pyrrolidin-1-yl)diazen-1-ium-1 and 2-diolate inhibits the reaction [Acetaminophen results in increased expression of OGG1 mRNA] CTD PMID:12540782 Ogg1 Rat paracetamol increases expression ISO Ogg1 (Mus musculus) 6480464 Acetaminophen results in increased expression of OGG1 mRNA CTD PMID:12540782 Ogg1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of OGG1 mRNA and Paraquat results in decreased expression of OGG1 protein CTD PMID:27993944 Ogg1 Rat paraquat affects response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 gene SNP affects the susceptibility to Paraquat CTD PMID:28460087 Ogg1 Rat parathion-methyl increases methylation ISO Ogg1 (Mus musculus) 6480464 Methyl Parathion results in increased methylation of OGG1 promoter CTD PMID:29540303 Ogg1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of OGG1 mRNA CTD PMID:24090815 Ogg1 Rat pioglitazone multiple interactions ISO Ogg1 (Mus musculus) 6480464 Pioglitazone inhibits the reaction [LEPR protein affects the expression of OGG1 protein] CTD PMID:35472412 Ogg1 Rat piperonyl butoxide multiple interactions ISO Ogg1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in decreased expression of OGG1 mRNA CTD PMID:20101389 Ogg1 Rat pirfenidone multiple interactions ISO Ogg1 (Mus musculus) 6480464 pirfenidone inhibits the reaction [Bleomycin results in increased expression of OGG1 protein] CTD PMID:35654123 Ogg1 Rat potassium bromate decreases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 gene mutant form results in decreased susceptibility to potassium bromate CTD PMID:25693136 Ogg1 Rat potassium bromate increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in increased susceptibility to potassium bromate CTD PMID:34196753 Ogg1 Rat potassium dichromate decreases expression ISO OGG1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of OGG1 mRNA CTD PMID:30496737 Ogg1 Rat pristane increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 gene mutant form results in increased susceptibility to pristane CTD PMID:33072095 Ogg1 Rat procyanidin B1 increases expression ISO Ogg1 (Mus musculus) 6480464 procyanidin B1 results in increased expression of OGG1 mRNA and procyanidin B1 results in increased expression of OGG1 protein CTD PMID:34684730 Ogg1 Rat quartz decreases expression ISO OGG1 (Homo sapiens) 6480464 Quartz results in decreased expression of OGG1 mRNA CTD PMID:27917503 Ogg1 Rat quercetin multiple interactions ISO OGG1 (Homo sapiens) 6480464 Quercetin promotes the reaction [Hydrogen Peroxide results in increased expression of OGG1 mRNA] CTD PMID:19651184 Ogg1 Rat quercetin increases expression ISO OGG1 (Homo sapiens) 6480464 Quercetin results in increased expression of OGG1 mRNA CTD PMID:19651184 Ogg1 Rat reactive oxygen species increases expression EXP 6480464 Reactive Oxygen Species results in increased expression of OGG1 mRNA CTD PMID:29085557 Ogg1 Rat reactive oxygen species affects expression ISO OGG1 (Homo sapiens) 6480464 Reactive Oxygen Species affects the expression of OGG1 mRNA CTD PMID:25800948 Ogg1 Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Estradiol results in decreased expression of OGG1 mRNA] and Resveratrol inhibits the reaction [Estradiol results in decreased expression of OGG1 protein] CTD PMID:24894866 Ogg1 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of OGG1 mRNA CTD PMID:33775663 Ogg1 Rat resveratrol increases expression ISO OGG1 (Homo sapiens) 6480464 resveratrol results in increased expression of OGG1 mRNA and resveratrol results in increased expression of OGG1 protein CTD PMID:22056336 Ogg1 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of OGG1 mRNA and resveratrol results in increased expression of OGG1 protein CTD PMID:24894866 Ogg1 Rat rosmarinic acid increases expression EXP 6480464 Rosmarinic Acid results in increased expression of OGG1 mRNA CTD PMID:18996367 Ogg1 Rat S-adenosyl-L-homocysteine multiple interactions ISO Ogg1 (Mus musculus) 6480464 Betaine inhibits the reaction [S-Adenosylhomocysteine results in decreased expression of OGG1 protein] more ... CTD PMID:22064374 Ogg1 Rat S-adenosyl-L-homocysteine decreases methylation ISO Ogg1 (Mus musculus) 6480464 S-Adenosylhomocysteine results in decreased methylation of OGG1 promoter CTD PMID:22064374 Ogg1 Rat S-adenosyl-L-homocysteine decreases expression ISO Ogg1 (Mus musculus) 6480464 S-Adenosylhomocysteine results in decreased expression of OGG1 mRNA and S-Adenosylhomocysteine results in decreased expression of OGG1 protein CTD PMID:22064374 Ogg1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO Ogg1 (Mus musculus) 6480464 Buthionine Sulfoximine affects the reaction [OGG1 protein affects the expression of SOD2 mRNA] CTD PMID:32585298 Ogg1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine affects response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 protein affects the susceptibility to Buthionine Sulfoximine CTD PMID:32585298 Ogg1 Rat SB 431542 multiple interactions ISO OGG1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OGG1 mRNA CTD PMID:27188386 Ogg1 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of OGG1 mRNA CTD PMID:19564919 Ogg1 Rat selenium atom multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Selenium co-treated with Arsenic] results in increased expression of OGG1 protein CTD PMID:20478284 Ogg1 Rat selenium atom increases expression ISO OGG1 (Homo sapiens) 6480464 Selenium results in increased expression of OGG1 protein CTD PMID:20478284 Ogg1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of OGG1 protein CTD PMID:23178243 Ogg1 Rat silicon dioxide decreases expression ISO OGG1 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of OGG1 mRNA CTD PMID:25351596 Ogg1 Rat sodium arsenite increases methylation ISO OGG1 (Homo sapiens) 6480464 sodium arsenite results in increased methylation of OGG1 promoter CTD PMID:33388378 Ogg1 Rat sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OGG1 mRNA CTD PMID:31542844 Ogg1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of OGG1 protein CTD PMID:26432159 Ogg1 Rat sodium arsenite increases expression ISO Ogg1 (Mus musculus) 6480464 sodium arsenite results in increased expression of OGG1 mRNA CTD PMID:20643705 Ogg1 Rat sodium arsenite decreases expression ISO Ogg1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of OGG1 mRNA CTD PMID:17558810 and PMID:20643705 Ogg1 Rat sodium arsenite multiple interactions ISO Ogg1 (Mus musculus) 6480464 [OGG1 gene mutant form results in increased susceptibility to sodium arsenite] which affects the expression of ACTA2 mRNA more ... CTD PMID:26438402 Ogg1 Rat sodium arsenite increases response to substance ISO Ogg1 (Mus musculus) 6480464 OGG1 gene mutant form results in increased susceptibility to sodium arsenite CTD PMID:26438402 Ogg1 Rat sodium arsenite decreases expression ISO OGG1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of OGG1 mRNA and sodium arsenite results in decreased expression of OGG1 protein CTD PMID:12359242 more ... Ogg1 Rat sodium arsenite multiple interactions ISO OGG1 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [sodium arsenite results in decreased expression of OGG1 protein] more ... CTD PMID:12359242 and PMID:33388378 Ogg1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of OGG1 mRNA CTD PMID:22561333 Ogg1 Rat sodium dichromate decreases expression ISO OGG1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of OGG1 mRNA and sodium bichromate results in decreased expression of OGG1 protein CTD PMID:11756223 Ogg1 Rat sodium dichromate increases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein polymorphism results in increased susceptibility to sodium bichromate CTD PMID:15734978 Ogg1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of OGG1 mRNA CTD PMID:19281266 Ogg1 Rat sterigmatocystin increases expression EXP 6480464 Sterigmatocystin results in increased expression of OGG1 mRNA CTD PMID:34126181 Ogg1 Rat styrene affects response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein polymorphism affects the susceptibility to Styrene CTD PMID:19563869 Ogg1 Rat styrene increases expression ISO OGG1 (Homo sapiens) 6480464 Styrene results in increased expression of OGG1 mRNA CTD PMID:21030303 Ogg1 Rat tamibarotene increases expression ISO OGG1 (Homo sapiens) 6480464 tamibarotene results in increased expression of OGG1 mRNA CTD PMID:15498508 Ogg1 Rat tert-butyl ethyl ether decreases expression EXP 6480464 ethyl tert-butyl ether results in decreased expression of OGG1 mRNA CTD PMID:24090815 Ogg1 Rat tetrachloromethane affects expression ISO Ogg1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of OGG1 mRNA CTD PMID:17484886 Ogg1 Rat tetrachloromethane multiple interactions ISO Ogg1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Carbon Tetrachloride] results in decreased expression of OGG1 mRNA CTD PMID:23288052 Ogg1 Rat Thiotepa decreases response to substance ISO OGG1 (Homo sapiens) 6480464 OGG1 protein results in decreased susceptibility to Thiotepa CTD PMID:11181913 and PMID:11431349 Ogg1 Rat Thymidine glycol multiple interactions ISO OGG1 (Homo sapiens) 6480464 thymidine glycol inhibits the reaction [OGG1 protein results in increased cleavage of 8-Hydroxy-2'-Deoxyguanosine] and thymidine glycol promotes the reaction [OGG1 protein results in increased cleavage of 8-Hydroxy-2'-Deoxyguanosine] CTD PMID:19193190 Ogg1 Rat titanium dioxide multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Cadmium Chloride co-treated with titanium dioxide] results in increased expression of OGG1 mRNA CTD PMID:21671166 Ogg1 Rat titanium dioxide decreases methylation ISO Ogg1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of OGG1 gene CTD PMID:35295148 Ogg1 Rat titanium dioxide increases methylation ISO Ogg1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of OGG1 gene CTD PMID:35295148 Ogg1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of OGG1 mRNA CTD PMID:25729387 Ogg1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of OGG1 mRNA CTD PMID:31129395 Ogg1 Rat trimethylarsine oxide increases expression EXP 6480464 trimethylarsine oxide results in increased expression of OGG1 mRNA CTD PMID:17481689 Ogg1 Rat valproic acid multiple interactions ISO OGG1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of OGG1 mRNA CTD PMID:17183730 Ogg1 Rat vincristine decreases expression ISO OGG1 (Homo sapiens) 6480464 Vincristine results in decreased expression of OGG1 mRNA CTD PMID:23649840 Ogg1 Rat vorinostat decreases expression ISO Ogg1 (Mus musculus) 6480464 Vorinostat results in decreased expression of OGG1 mRNA and Vorinostat results in decreased expression of OGG1 protein CTD PMID:32512035 Ogg1 Rat wogonin multiple interactions ISO Ogg1 (Mus musculus) 6480464 wogonin inhibits the reaction [Etoposide results in decreased expression of OGG1 mRNA] CTD PMID:23872129
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) (+)-pilocarpine (EXP) (S)-nicotine (ISO) 1,1'-azobis(N,N-dimethylformamide) (ISO) 1,2-dimethylhydrazine (EXP) 1,4-benzoquinone (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-diamino-5-formamido-4-hydroxypyrimidine (ISO) 2-aminobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 7,8-dihydro-8-oxoguanine (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) 8-hydroxy-2'-deoxyguanosine (ISO) acrolein (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) alpha-pinene (ISO) ammonium chloride (EXP) aniline (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) aurintricarboxylic acid (ISO) belinostat (ISO) benzene (ISO) benzo[a]pyrene (ISO) beryllium dichloride (ISO) bezafibrate (ISO) biphenyl-4-amine (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bleomycin A2 (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) camphene (EXP) carbon atom (ISO) carmustine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium atom (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclophosphamide (ISO) DDT (EXP) deoxynivalenol (ISO) dexamethasone (ISO) Diacetoxyscirpenol (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicyclanil (ISO) diethyl maleate (ISO) dimethylarsinic acid (EXP,ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental carbon (ISO) elemental selenium (ISO) entinostat (ISO) ethanol (ISO) etoposide (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) Gentiopicrin (ISO) geraniol (EXP) glutathione (ISO) glycine betaine (ISO) glyphosate (ISO) gold atom (ISO) gold(0) (ISO) hydralazine (ISO) hydrazine (ISO) hydrazines (ISO) hydrogen peroxide (ISO) idarubicin (ISO) imidacloprid (EXP) indometacin (ISO) L-ascorbic acid (ISO) lead(0) (ISO) lithium atom (ISO) lithium hydride (ISO) lupeol (ISO) mancozeb (ISO) manganese atom (ISO) manganese(0) (ISO) melatonin (ISO) menadione (ISO) mercury atom (ISO) mercury(0) (ISO) metformin (ISO) methamphetamine (EXP,ISO) methyl methanesulfonate (ISO) methyl tert-butyl ether (EXP) methylarsonic acid (EXP) miconazole (EXP) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotophos (ISO) myristicin (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) nickel atom (ISO) nicotine (ISO) nimesulide (EXP) O-methyleugenol (EXP) ochratoxin A (EXP) oxaliplatin (EXP) oxirane (EXP,ISO) ozone (EXP,ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) parathion-methyl (ISO) phenobarbital (EXP) pioglitazone (ISO) piperonyl butoxide (ISO) pirfenidone (ISO) potassium bromate (ISO) potassium dichromate (ISO) pristane (ISO) procyanidin B1 (ISO) quartz (ISO) quercetin (ISO) reactive oxygen species (EXP,ISO) resveratrol (EXP,ISO) rosmarinic acid (EXP) S-adenosyl-L-homocysteine (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 431542 (ISO) SCH 23390 (EXP) selenium atom (ISO) silicon dioxide (EXP,ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) Soman (EXP) sterigmatocystin (EXP) styrene (ISO) tamibarotene (ISO) tert-butyl ethyl ether (EXP) tetrachloromethane (ISO) Thiotepa (ISO) Thymidine glycol (ISO) titanium dioxide (ISO) topotecan (EXP) tributylstannane (EXP) trimethylarsine oxide (EXP) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) wogonin (ISO)
1.
8-oxoguanine DNA glycosylase, but not Kin17 protein, is translocated and differentially regulated by estrogens in rat brain cells.
Araneda S, etal., Neuroscience. 2005;136(1):135-46. Epub 2005 Sep 21.
2.
Alterations of the DNA repair gene OGG1 in human clear cell carcinomas of the kidney.
Audebert M, etal., Cancer Res. 2000 Sep 1;60(17):4740-4.
3.
Dietary fish oil reduces oxidative DNA damage in rat colonocytes.
Bancroft LK, etal., Free Radic Biol Med. 2003 Jul 15;35(2):149-59.
4.
Two functional variations in 5'-UTR of hoGG1 gene associated with the risk of breast cancer in Chinese.
Chen X, etal., Breast Cancer Res Treat. 2011 Jun;127(3):795-803. doi: 10.1007/s10549-010-1284-2. Epub 2010 Dec 14.
5.
Evidence of alterations in base excision repair of oxidative DNA damage during spontaneous hepatocarcinogenesis in Long Evans Cinnamon rats.
Choudhury S, etal., Cancer Res. 2003 Nov 15;63(22):7704-7.
6.
DNA repair gene variants in endometrial carcinoma.
Cincin ZB, etal., Med Oncol. 2012 Dec;29(4):2949-54. doi: 10.1007/s12032-012-0162-7. Epub 2012 Jan 22.
7.
Zhonghua bing li xue za zhi Chinese journal of pathology
Cong W, etal., Zhonghua Bing Li Xue Za Zhi. 2001 Jun;30(3):183-7.
8.
Multiple genetic alterations involved in the tumorigenesis of human cholangiocarcinoma: a molecular genetic and clinicopathological study.
Cong WM, etal., J Cancer Res Clin Oncol. 2001;127(3):187-92.
9.
Oxidative stress-induced retinal damage up-regulates DNA polymerase gamma and 8-oxoguanine-DNA-glycosylase in photoreceptor synaptic mitochondria.
Cortina MS, etal., Exp Eye Res. 2005 Dec;81(6):742-50. Epub 2005 Jun 24.
10.
DNA repair gene polymorphisms and prostate cancer risk in South Australia--results of a pilot study.
Dhillon VS, etal., Urol Oncol. 2011 Nov-Dec;29(6):641-6. doi: 10.1016/j.urolonc.2009.08.013. Epub 2009 Nov 13.
11.
Enhanced mtDNA repair capacity protects pulmonary artery endothelial cells from oxidant-mediated death.
Dobson AW, etal., Am J Physiol Lung Cell Mol Physiol 2002 Jul;283(1):L205-10.
12.
Detecting pathway-based gene-gene and gene-environment interactions in pancreatic cancer.
Duell EJ, etal., Cancer Epidemiol Biomarkers Prev. 2008 Jun;17(6):1470-9.
13.
Folate deficiency alters hepatic and colon MGMT and OGG-1 DNA repair protein expression in rats but has no effect on genome-wide DNA methylation.
Duthie SJ, etal., Cancer Prev Res (Phila Pa). 2010 Jan;3(1):92-100.
14.
Integrated analysis of high-resolution DNA methylation profiles, gene expression, germline genotypes and clinical end points in breast cancer patients.
Fleischer T, etal., Int J Cancer. 2014 Jun 1;134(11):2615-25. doi: 10.1002/ijc.28606. Epub 2014 Jan 6.
15.
Expression of 8-oxoguanine DNA glycosylase (OGG1) in Parkinson's disease and related neurodegenerative disorders.
Fukae J, etal., Acta Neuropathol. 2005 Mar;109(3):256-62. Epub 2004 Nov 17.
16.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
17.
Polymorphisms of DNA repair genes OGG1 and XPD and the risk of age-related cataract in Egyptians.
Gharib AF, etal., Mol Vis. 2014 May 21;20:661-9. eCollection 2014.
18.
Association between genetic variants of DNA repair genes and coronary artery disease.
Gokkusu C, etal., Genet Test Mol Biomarkers. 2013 Apr;17(4):307-13. doi: 10.1089/gtmb.2012.0383. Epub 2013 Jan 31.
19.
Insight into mechanism of oxidative DNA damage in angiomyolipomas from TSC patients.
Habib SL Mol Cancer. 2009 Mar 5;8:13. doi: 10.1186/1476-4598-8-13.
20.
Genetic polymorphisms in OGG1 and their association with angiomyolipoma, a benign kidney tumor in patients with tuberous sclerosis.
Habib SL, etal., Cancer Biol Ther. 2008 Jan;7(1):23-7. Epub 2007 Oct 8.
21.
Tuberin haploinsufficiency is associated with the loss of OGG1 in rat kidney tumors.
Habib SL, etal., Mol Cancer. 2008 Jan 24;7:10.
22.
Ebselen attenuates oxidative DNA damage and enhances its repair activity in the thalamus after focal cortical infarction in hypertensive rats.
He M, etal., Brain Res. 2007 Nov 21;1181:83-92. Epub 2007 Sep 8.
23.
Human 8-oxoguanine-DNA glycosylase-1 is downregulated in human basal cell carcinoma.
Huang XX, etal., Mol Genet Metab. 2012 May;106(1):127-30. doi: 10.1016/j.ymgme.2012.02.017. Epub 2012 Mar 3.
24.
Genetic polymorphisms in the base excision repair pathway and cancer risk: a HuGE review.
Hung RJ, etal., Am J Epidemiol. 2005 Nov 15;162(10):925-42. Epub 2005 Oct 12.
25.
Branched-chain amino acid-enriched nutrients stimulate antioxidant DNA repair in a rat model of liver injury induced by carbon tetrachloride.
Ichikawa K, etal., Mol Biol Rep. 2012 Dec;39(12):10803-10. doi: 10.1007/s11033-012-1974-4. Epub 2012 Oct 9.
26.
Mitochondrial DNA damage and impaired base excision repair during epileptogenesis.
Jarrett SG, etal., Neurobiol Dis. 2008 Apr;30(1):130-8. Epub 2008 Jan 5.
27.
Genetic polymorphism of hOGG1 and risk of pterygium in Chinese.
Kau HC, etal., Eye (Lond). 2004 Jun;18(6):635-9.
28.
Impact of genetic polymorphisms in base excision repair genes on the risk of breast cancer in a Korean population.
Kim KY, etal., Gene. 2013 Dec 15;532(2):192-6. doi: 10.1016/j.gene.2013.09.069. Epub 2013 Sep 25.
29.
Formation of 8-hydroxydeoxyguanosine and cell-cycle arrest in the rat liver via generation of oxidative stress by phenobarbital: association with expression profiles of p21(WAF1/Cip1), cyclin D1 and Ogg1.
Kinoshita A, etal., Carcinogenesis. 2002 Feb;23(2):341-9.
30.
Immunolocalization of 8-OHdG and OGG1 in pancreatic islets of streptozotocin-induced diabetic rats.
Ku YP, etal., Acta Histochem. 2009;111(2):138-44. Epub 2008 Aug 3.
31.
Reduced expression of DNA repair genes (XRCC1, XPD, and OGG1) in squamous cell carcinoma of head and neck in North India.
Kumar A, etal., Tumour Biol. 2012 Feb;33(1):111-9. doi: 10.1007/s13277-011-0253-7. Epub 2011 Nov 15.
32.
8-Oxoguanine formation induced by chronic UVB exposure makes Ogg1 knockout mice susceptible to skin carcinogenesis.
Kunisada M, etal., Cancer Res. 2005 Jul 15;65(14):6006-10.
33.
Inducible repair of oxidative DNA lesions in the rat brain after transient focal ischemia and reperfusion.
Lan J, etal., J Cereb Blood Flow Metab. 2003 Nov;23(11):1324-39.
34.
Effects of base excision repair gene polymorphisms on pancreatic cancer survival.
Li D, etal., Int J Cancer. 2007 Apr 15;120(8):1748-54.
35.
Oxidative DNA damage and 8-hydroxy-2-deoxyguanosine DNA glycosylase/apurinic lyase in human breast cancer.
Li D, etal., Mol Carcinog. 2001 Aug;31(4):214-23.
36.
Single nucleotide polymorphisms of DNA base-excision repair genes (APE1, OGG1 and XRCC1) associated with breast cancer risk in a Chinese population.
Luo H, etal., Asian Pac J Cancer Prev. 2014;15(3):1133-40.
37.
Potential role for 8-oxoguanine DNA glycosylase in regulating inflammation.
Mabley JG, etal., FASEB J. 2005 Feb;19(2):290-2. Epub 2004 Dec 1.
38.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
39.
Synergistic effects of polymorphisms in DNA repair genes and endogenous estrogen exposure on female breast cancer risk.
Ming-Shiean H, etal., Ann Surg Oncol. 2010 Mar;17(3):760-71.
40.
Protective association exhibited by the single nucleotide polymorphism (SNP) rs1052133 in the gene human 8-oxoguanine DNA glycosylase (hOGG1) with the risk of squamous cell carcinomas of the head & neck (SCCHN) among north Indians.
Mitra AK, etal., Indian J Med Res. 2011 Jun;133:605-12.
41.
Ethanol modulates rat hepatic DNA repair functions.
Navasumrit P, etal., Alcohol Alcohol. 2001 Sep-Oct;36(5):369-76.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
44.
DNA glycosylases involved in base excision repair may be associated with cancer risk in BRCA1 and BRCA2 mutation carriers.
Osorio A, etal., PLoS Genet. 2014 Apr 3;10(4):e1004256. doi: 10.1371/journal.pgen.1004256. eCollection 2014 Apr.
45.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
46.
Cadmium exposure down-regulates 8-oxoguanine DNA glycosylase expression in rat lung and alveolar epithelial cells.
Potts RJ, etal., Toxicology. 2003 Mar 3;184(2-3):189-202.
47.
Rat 7,8-dihydro-8-oxoguanine DNA glycosylase: substrate specificity, kinetics and cleavagemechanism at an apurinic site.
Prieto Alamo MJ, etal., Nucleic Acids Res 1998 Nov 15;26(22):5199-202.
48.
Exercise improves import of 8-oxoguanine DNA glycosylase into the mitochondrial matrix of skeletal muscle and enhances the relative activity.
Radak Z, etal., Free Radic Biol Med. 2009 Jan 15;46(2):238-43. doi: 10.1016/j.freeradbiomed.2008.10.022. Epub 2008 Oct 18.
49.
GOA pipeline
RGD automated data pipeline
50.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
51.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
52.
OGG1 polymorphisms and breast cancer risk.
Rossner P Jr, etal., Cancer Epidemiol Biomarkers Prev. 2006 Apr;15(4):811-5.
53.
The DNA glycosylase Ogg1 defends against oxidant-induced mtDNA damage and apoptosis in pulmonary artery endothelial cells.
Ruchko MV, etal., Free Radic Biol Med. 2011 May 1;50(9):1107-13. doi: 10.1016/j.freeradbiomed.2010.10.692. Epub 2010 Oct 20.
54.
A functional Ser326Cys polymorphism in hOGG1 is associated with noise-induced hearing loss in a Chinese population.
Shen H, etal., PLoS One. 2014 Mar 5;9(3):e89662. doi: 10.1371/journal.pone.0089662. eCollection 2014.
55.
Salivary analysis of oral cancer biomarkers.
Shpitzer T, etal., Br J Cancer. 2009 Oct 6;101(7):1194-8. doi: 10.1038/sj.bjc.6605290.
56.
Mechanism of oxidative DNA damage in diabetes: tuberin inactivation and downregulation of DNA repair enzyme 8-oxo-7,8-dihydro-2'-deoxyguanosine-DNA glycosylase.
Simone S, etal., Diabetes. 2008 Oct;57(10):2626-36. doi: 10.2337/db07-1579. Epub 2008 Jul 3.
57.
Polymorphisms of DNA repair genes in endometrial cancer.
Sobczuk A, etal., Pathol Oncol Res. 2012 Oct;18(4):1015-20. Epub 2012 Apr 28.
58.
Single-nucleotide polymorphisms of DNA repair genes OGG1 and XRCC1: association with gallbladder cancer in North Indian population.
Srivastava A, etal., Ann Surg Oncol. 2009 Jun;16(6):1695-703. Epub 2009 Mar 6.
59.
Polymorphisms in ERCC2, MSH2, and OGG1 DNA repair genes and gallbladder cancer risk in a population of Northern India.
Srivastava K, etal., Cancer. 2010 Jul 1;116(13):3160-9. doi: 10.1002/cncr.25063.
60.
Study of DNA damage via the comet assay and base excision repair activities in rat brain neurons and astrocytes during aging.
Swain U and Subba Rao K, Mech Ageing Dev. 2011 Aug;132(8-9):374-81. doi: 10.1016/j.mad.2011.04.012. Epub 2011 May 11.
61.
Association between DNA damage, DNA repair genes variability and clinical characteristics in breast cancer patients.
Synowiec E, etal., Mutat Res. 2008 Dec 15;648(1-2):65-72. doi: 10.1016/j.mrfmmm.2008.09.014. Epub 2008 Oct 10.
62.
Association of the 399Arg/Gln XRCC1, the 194 Arg/Trp XRCC1, the 326Ser/Cys OGG1, and the 324Gln/His MUTYH gene polymorphisms with clinical parameters and the risk for development of primary open-angle glaucoma.
Szaflik JP, etal., Mutat Res. 2013 Apr 30;753(1):12-22. doi: 10.1016/j.mrgentox.2012.12.019. Epub 2013 Mar 7.
63.
The 8-oxoguanine DNA N-glycosylase 1 (hOGG1) Ser326Cys variant affects the susceptibility to Graves' disease.
Tanrikulu S, etal., Cell Biochem Funct. 2011 Apr;29(3):244-8. doi: 10.1002/cbf.1742. Epub 2011 Feb 24.
64.
Accumulation of 8-oxoguanine in the cellular DNA and the alteration of the OGG1 expression during ischemia-reperfusion injury in the rat kidney.
Tsuruya K, etal., DNA Repair (Amst). 2003 Feb 3;2(2):211-29.
65.
Islet expression of the DNA repair enzyme 8-oxoguanosine DNA glycosylase (Ogg1) in human type 2 diabetes.
Tyrberg B, etal., BMC Endocr Disord. 2002 Apr 25;2(1):2.
66.
Disrupted placental vitamin D metabolism and calcium signaling in gestational diabetes and pre-eclampsia patients.
Varshney S, etal., Endocrine. 2023 Apr;80(1):191-200. doi: 10.1007/s12020-022-03272-9. Epub 2022 Dec 8.
67.
No association between OGG1 Ser326Cys and risk of basal cell carcinoma.
Vogel U, etal., Cancer Epidemiol Biomarkers Prev. 2004 Oct;13(10):1680-1.
68.
Acetoaminophen-induced accumulation of 8-oxodeoxyguanosine through reduction of Ogg1 DNA repair enzyme in C6 glioma cells.
Wan J, etal., Exp Mol Med. 2004 Feb 29;36(1):71-7.
69.
Association of hOGG1 and XPD polymorphisms with urothelial carcinoma in Taiwan.
Wang YH, etal., Anticancer Res. 2011 Nov;31(11):3939-44.
70.
Genetic polymorphisms in base-excision repair pathway genes and risk of breast cancer.
Zhang Y, etal., Cancer Epidemiol Biomarkers Prev. 2006 Feb;15(2):353-8.
71.
Expression changes in DNA repair enzymes and mitochondrial DNA damage in aging rat lens.
Zhang Y, etal., Mol Vis. 2010 Aug 27;16:1754-63.
72.
Genetic polymorphisms in DNA repair genes OGG1, APE1, XRCC1, and XPD and the risk of age-related cataract.
Zhang Y, etal., Ophthalmology. 2012 May;119(5):900-6. doi: 10.1016/j.ophtha.2011.11.004. Epub 2012 Feb 4.
73.
Susceptibility of XPD and hOGG1 genetic variants to prostate cancer.
Zhou C, etal., Biomed Rep. 2013 Jul;1(4):679-683. Epub 2013 May 30.
Ogg1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 148,030,237 - 148,037,599 (+) NCBI GRCr8 mRatBN7.2 4 146,474,701 - 146,481,959 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 146,474,750 - 146,484,766 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 151,859,153 - 151,865,412 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 147,639,996 - 147,646,255 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 146,261,532 - 146,267,801 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 145,282,828 - 145,289,367 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 145,282,797 - 145,289,326 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 208,580,193 - 208,586,457 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 149,209,745 - 149,219,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 149,454,585 - 149,463,922 (+) NCBI Celera 4 135,032,266 - 135,038,520 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
OGG1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 9,749,952 - 9,783,108 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 9,749,944 - 9,788,219 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 9,791,636 - 9,808,334 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 9,765,705 - 9,783,342 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 9,766,653 - 9,783,311 NCBI Celera 3 9,726,330 - 9,743,054 (+) NCBI Celera Cytogenetic Map 3 p25.3 NCBI HuRef 3 9,727,975 - 9,744,701 (+) NCBI HuRef CHM1_1 3 9,741,823 - 9,758,548 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 9,741,907 - 9,758,605 (+) NCBI T2T-CHM13v2.0
Ogg1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 113,303,959 - 113,311,149 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 113,303,933 - 113,312,029 (+) Ensembl GRCm39 Ensembl GRCm38 6 113,326,972 - 113,334,877 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 113,326,972 - 113,335,068 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 113,276,970 - 113,284,182 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 113,292,788 - 113,299,961 (+) NCBI MGSCv36 mm8 Celera 6 115,153,980 - 115,161,188 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 52.75 NCBI
Ogg1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955561 1,277,365 - 1,282,793 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955561 1,277,362 - 1,282,949 (+) NCBI ChiLan1.0 ChiLan1.0
OGG1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 9,761,821 - 9,801,743 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 9,766,593 - 9,806,794 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 9,702,311 - 9,742,283 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 9,940,955 - 9,972,658 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 9,940,955 - 9,947,335 (+) Ensembl panpan1.1 panPan2
OGG1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 8,486,150 - 8,491,448 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 8,480,005 - 8,491,264 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 8,519,224 - 8,524,513 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 8,515,436 - 8,520,730 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 8,515,437 - 8,520,524 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 8,237,911 - 8,243,202 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 8,582,435 - 8,587,727 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 8,556,049 - 8,561,340 (-) NCBI UU_Cfam_GSD_1.0
Ogg1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 15,490,887 - 15,501,164 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 3,413,282 - 3,418,831 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 3,411,106 - 3,418,826 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OGG1
OGG1
Ogg1
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
4
145286982
145286983
C
G
snv
WKY/N (MCW) View more Information
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 40 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000011352 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat
RH128087
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 146,480,937 - 146,481,139 (+) MAPPER mRatBN7.2 Rnor_6.0 4 145,289,042 - 145,289,243 NCBI Rnor6.0 Rnor_5.0 4 208,586,192 - 208,586,392 UniSTS Rnor5.0 Celera 4 135,038,254 - 135,038,455 UniSTS RH 3.4 Map 4 937.4 UniSTS Cytogenetic Map 4 q42 UniSTS
AI505105
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 146,481,267 - 146,481,394 (+) MAPPER mRatBN7.2 Rnor_6.0 4 145,289,372 - 145,289,498 NCBI Rnor6.0 Rnor_5.0 4 208,586,521 - 208,586,647 UniSTS Rnor5.0 Celera 4 135,038,584 - 135,038,710 UniSTS Cytogenetic Map 4 q42 UniSTS
D6Ertd263e
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 146,481,234 - 146,481,453 (+) MAPPER mRatBN7.2 Rnor_6.0 4 145,289,339 - 145,289,557 NCBI Rnor6.0 Rnor_5.0 4 208,586,488 - 208,586,706 UniSTS Rnor5.0 Celera 4 135,038,551 - 135,038,769 UniSTS Cytogenetic Map 4 q42 UniSTS
RH137514
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 146,481,260 - 146,481,393 (+) MAPPER mRatBN7.2 Rnor_6.0 4 145,289,365 - 145,289,497 NCBI Rnor6.0 Rnor_5.0 4 208,586,514 - 208,586,646 UniSTS Rnor5.0 Celera 4 135,038,577 - 135,038,709 UniSTS Cytogenetic Map 4 q42 UniSTS
Ogg1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 146,478,876 - 146,480,164 (+) MAPPER mRatBN7.2 Rnor_6.0 4 145,286,983 - 145,288,270 NCBI Rnor6.0 Rnor_5.0 4 208,584,133 - 208,585,420 UniSTS Rnor5.0 RGSC_v3.4 4 149,216,891 - 149,218,178 UniSTS RGSC3.4 Celera 4 135,036,195 - 135,037,482 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000085766 ⟹ ENSRNOP00000070483
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 146,474,750 - 146,484,766 (+) Ensembl Rnor_6.0 Ensembl 4 145,282,797 - 145,289,326 (+) Ensembl
RefSeq Acc Id:
NM_030870 ⟹ NP_110497
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 148,030,586 - 148,036,851 (+) NCBI mRatBN7.2 4 146,474,936 - 146,481,204 (+) NCBI Rnor_6.0 4 145,283,043 - 145,289,308 (+) NCBI Rnor_5.0 4 208,580,193 - 208,586,457 (+) NCBI RGSC_v3.4 4 149,209,745 - 149,219,081 (+) RGD Celera 4 135,032,266 - 135,038,520 (+) RGD
Sequence:
ATTGGACGTAATGGGCTGGGGACTGCTATCCAAATGTTATTCAGTTCCAGCCTGTCTAGCAGCATGAGACATCGCACCCTAACCTCCAGCCCGGCCCTCTGGGCCTCTATTCCGTGTCCACGCTCTGA
hide sequence
RefSeq Acc Id:
XM_017592906 ⟹ XP_017448395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 148,030,640 - 148,037,599 (+) NCBI mRatBN7.2 4 146,474,966 - 146,481,959 (+) NCBI Rnor_6.0 4 145,283,120 - 145,289,367 (+) NCBI
Sequence:
CCTAACCTCCAGCCCGGCCCTCTGGGCCTCTATTCCGTGTCCACGCTCTGAGCTGCGTCTGGACCTGGTTTTAGCTTCTGGACAGTCCTTCCGGGCTGTCTGCTGGGATGCCCAGGTGGAGGGAGCAA
hide sequence
RefSeq Acc Id:
XM_039108420 ⟹ XP_038964348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 148,030,620 - 148,037,599 (+) NCBI mRatBN7.2 4 146,474,749 - 146,481,956 (+) NCBI
RefSeq Acc Id:
XM_063286744 ⟹ XP_063142814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 148,030,237 - 148,035,936 (+) NCBI
RefSeq Acc Id:
XM_063286745 ⟹ XP_063142815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 148,030,237 - 148,036,675 (+) NCBI
RefSeq Acc Id:
NP_110497 ⟸ NM_030870
- UniProtKB:
O70249 (UniProtKB/Swiss-Prot), A6IBQ2 (UniProtKB/TrEMBL)
- Sequence:
MLFSSSLSSSMRHRTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHFQSVAQKFQ
hide sequence
RefSeq Acc Id:
XP_017448395 ⟸ XM_017592906
- Peptide Label:
isoform X1
- Sequence:
MPRWREQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHFQSVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000070483 ⟸ ENSRNOT00000085766
RefSeq Acc Id:
XP_038964348 ⟸ XM_039108420
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063142815 ⟸ XM_063286745
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063142814 ⟸ XM_063286744
- Peptide Label:
isoform X2
RGD ID: 13693295 Promoter ID: EPDNEW_R3819 Type: multiple initiation site Name: Ogg1_1 Description: 8-oxoguanine DNA glycosylase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 145,282,840 - 145,282,900 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-25
Ogg1
8-oxoguanine DNA glycosylase
Ogg1
8-oxoguanine DNA-glycosylase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Ogg1
8-oxoguanine DNA-glycosylase 1
8-oxoguanine-DNA-glycosylase
Name updated
1299863 APPROVED
2002-08-07
Ogg1
8-oxoguanine-DNA-glycosylase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_function
excises 8-oxoG from DNA with preference for duplex DNA containing 8-oxoG:C base pairs
729091
gene_process
protected against Xanthine Oxidase-induced mtDNA damage
628343
