Advanced Search (OLGA)

Gene: Rab3c (RAB3C, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab3c

Name:

RAB3C, member RAS oncogene family

RGD ID:

620923

Description:

Predicted to enable G protein activity; GTP-dependent protein binding activity; and myosin V binding activity. Predicted to be involved in antigen processing and presentation and exocytosis. Predicted to act upstream of or within regulation of exocytosis. Is active in synaptic vesicle membrane. Orthologous to human RAB3C (RAB3C, member RAS oncogene family); INTERACTS WITH 17alpha-ethynylestradiol; ammonium chloride; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ras-related protein Rab-3C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	43,353,822 - 43,577,226 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	43,361,093 - 43,577,022 (-)	Ensembl				GRCr8
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	48,731,477 - 48,966,584 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	46,790,202 - 47,025,307 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	41,643,172 - 41,878,316 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	37,457,041 - 37,671,693 (-)	NCBI		Celera
RGSC_v3.1	2	41,377,620 - 41,592,928 (-)	NCBI
Cytogenetic Map	2	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

cocaine (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP,ISO)

dimethyl sulfoxide (ISO)

dorsomorphin (ISO)

ethanol (ISO)

folic acid (ISO)

fonofos (ISO)

L-citrulline (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

methapyrilene (ISO)

methylmercury chloride (ISO)

O-methyleugenol (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

parathion (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium fluoride (ISO)

terbufos (ISO)

tipifarnib (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation (ISO)

exocytosis (IBA,IEA)

intracellular protein transport (IEA)

protein transport (IEA)

regulation of exocytosis (IEA,ISO)

Cellular Component

endosome (IBA)

perinuclear region of cytoplasm (ISO)

plasma membrane (IBA,IEA)

secretory granule (IEA)

synaptic vesicle (IBA,IEA,ISO)

synaptic vesicle membrane (IDA,IEP)

vesicle (ISO)

Molecular Function

G protein activity (IEA,ISS)

GTP binding (IEA)

GTP-dependent protein binding (ISO)

GTPase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

myosin V binding (IBA,ISO)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Insulin and okadaic acid induce Rab4 redistribution in adipocytes.	Cormont M, etal., J Biol Chem. 1993 Sep 15;268(26):19491-7.
2.	Rab3C is a synaptic vesicle protein that dissociates from synaptic vesicles after stimulation of exocytosis.	Fischer von Mollard G, etal., J Biol Chem. 1994 Apr 15;269(15):10971-4.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Cloning and tissue expression of the rat RAB 3C GTP-binding protein.	Viggeswarapu M and Wildey GM, Biochem Biophys Res Commun 1996 Oct 23;227(3):645-50.
10.	Isolation and characterization of a GDP/GTP exchange protein specific for the Rab3 subfamily small G proteins.	Wada M, etal., J Biol Chem 1997 Feb 14;272(7):3875-8.
11.	The RIM/NIM family of neuronal C2 domain proteins. Interactions with Rab3 and a new class of Src homology 3 domain proteins.	Wang Y, etal., J Biol Chem 2000 Jun 30;275(26):20033-44.

Additional References at PubMed

PMID:8841986	PMID:9252191	PMID:12167638	PMID:12192047	PMID:19717423	PMID:21262767	PMID:22871113	PMID:24006491	PMID:24625528	PMID:24891604	PMID:28131823	PMID:29476059

Genomics

Comparative Map Data

Rab3c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	43,353,822 - 43,577,226 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	43,361,093 - 43,577,022 (-)	Ensembl				GRCr8
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	48,731,477 - 48,966,584 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	46,790,202 - 47,025,307 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	41,643,172 - 41,878,316 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	37,457,041 - 37,671,693 (-)	NCBI		Celera
RGSC_v3.1	2	41,377,620 - 41,592,928 (-)	NCBI
Cytogenetic Map	2	q14	NCBI

RAB3C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	58,582,152 - 58,859,394 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	58,582,221 - 58,859,394 (+)	Ensembl			hg38	GRCh38
GRCh37	5	57,877,979 - 58,155,221 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	57,914,696 - 58,183,163 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	57,914,695 - 58,183,162	NCBI
Celera	5	54,817,320 - 55,087,837 (+)	NCBI		Celera
Cytogenetic Map	5	q11.2	NCBI
HuRef	5	54,835,744 - 55,104,743 (+)	NCBI		HuRef
CHM1_1	5	57,878,581 - 58,147,206 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	59,399,478 - 59,677,989 (+)	NCBI		T2T-CHM13v2.0

Rab3c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	110,190,721 - 110,417,530 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	110,190,721 - 110,417,530 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	110,054,187 - 110,280,996 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	110,054,187 - 110,280,996 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	110,844,395 - 111,070,414 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	111,181,960 - 111,400,980 (-)	NCBI		MGSCv36	mm8
Celera	13	114,388,532 - 114,614,165 (-)	NCBI		Celera
Cytogenetic Map	13	D2.1	NCBI
cM Map	13	61.19	NCBI

Rab3c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	9,343,388 - 9,578,209 (-)	Ensembl
ChiLan1.0	NW_004955446	9,335,298 - 9,577,919 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB3C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	55,061,045 - 55,339,383 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	53,214,677 - 53,493,015 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	55,150,508 - 55,428,094 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	56,787,165 - 57,063,795 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	56,795,195 - 57,062,710 (-)	Ensembl			panPan2	panpan1.1

RAB3C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	45,459,068 - 45,731,994 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	45,440,473 - 45,725,487 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	42,530,424 - 42,803,381 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	45,944,023 - 46,220,176 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	45,925,423 - 46,220,176 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	43,014,052 - 43,287,216 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	43,820,186 - 44,092,814 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	44,640,261 - 44,913,449 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab3c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	200,393,137 - 200,649,380 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	9,337,166 - 9,585,960 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	9,559,485 - 9,585,893 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB3C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	37,412,909 - 37,728,502 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	37,411,931 - 37,729,583 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	40,179,105 - 40,489,378 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB3C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	54,741,211 - 55,028,023 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666049	3,657,742 - 3,953,967 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab3c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	429,941 - 677,324 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624759	421,978 - 678,433 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab3c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	186,744,725 - 186,954,409 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab3c
1639 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	139
Count of miRNA genes:	116
Interacting mature miRNAs:	124
Transcripts:	ENSRNOT00000015871
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	36750344	81750344	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	35614083	53462005	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9685065	Swd6	Spike wave discharge measurement QTL 6	5.8	0.01	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge rate (CMO:0001739)	2	40957423	50526673	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	36868643	81868643	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	33269996	78269996	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	10	24	133	63	62	31	29	31	6	172	75	3	113	44	66	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001433831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_133536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U37099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U54807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015871 ⟹ ENSRNOP00000015871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	43,361,093 - 43,577,022 (-)	Ensembl
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086851 ⟹ ENSRNOP00000073277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	43,361,093 - 43,558,115 (-)	Ensembl
mRatBN7.2 Ensembl	2	41,627,720 - 41,824,745 (-)	Ensembl
Rnor_6.0 Ensembl	2	41,571,186 - 41,784,929 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116600 ⟹ ENSRNOP00000096986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	43,361,093 - 43,575,943 (-)	Ensembl
mRatBN7.2 Ensembl	2	41,627,720 - 41,842,670 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118628 ⟹ ENSRNOP00000094469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	43,372,097 - 43,575,943 (-)	Ensembl
mRatBN7.2 Ensembl	2	41,638,724 - 41,842,573 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000170596 ⟹ ENSRNOP00000104946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	43,361,093 - 43,575,369 (-)	Ensembl

RefSeq Acc Id:

NM_133536 ⟹ NP_598220

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	43,361,093 - 43,575,943 (-)	NCBI
mRatBN7.2	2	41,627,720 - 41,842,573 (-)	NCBI
Rnor_6.0	2	41,570,955 - 41,785,702 (-)	NCBI
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	RGD
Celera	2	37,457,041 - 37,671,693 (-)	RGD

Sequence:

show sequence

GCAGAGAGCGCTCAGGCTGTGCACGCTTGACCAGGCTCCCGGACCAGAGCTGTCCTAGCAAGAG
AGAAAAGGACATTTGCCTACAATGAGACACGAGGCGCCCATGCAGATGGCCTCGGCACAAGATG
CCAGGTTTGGTCAGAAAGACTCTTCTGACCAGAACTTCGACTACATGTTCAAGTTGCTGATCAT
TGGCAATAGCAGCGTGGGCAAAACATCCTTCCTGTTCCGCTATGCTGATGACTCCTTCACGTCT
GCCTTTGTCAGCACGGTCGGCATCGATTTCAAAGTAAAAACTGTCTTCAAAAATGAAAAGAGAA
TCAAGCTTCAGATTTGGGACACAGCAGGCCAGGAAAGATACAGGACCATCACCACAGCCTATTA
TCGAGGGGCCATGGGCTTCATTTTAATGTATGACATCACAAATGAAGAATCCTTCAACGCTGTA
CAAGATTGGTCAACTCAGATCAAAACATATTCCTGGGATAATGCCCAGGTTATACTGGTCGGAA
ACAAATGTGACATGGAAGACGAACGGGTGGTCTCAACTGAGAGAGGGCGCCACTTAGGAGAGCA
GCTCGGGTTTGAGTTTTTTGAAACCAGCGCCAAGGATAACATCAACGTGAAGCAAACCTTTGAG
CGCCTCGTAGATATCATCTGTGACAAAATGTCAGAGAGCTTGGAGACTGACCCAGCCATCACAG
GCGCCAAGCAGAGCACGAGGCTCAAGGAAACCCCTCCTCCACCACAGCCCAACTGTGGCTGCTA
ATGTCCCCCCGCACAGGAGCTCCAAGGGCCCCCAGAGCAGCCAAGAAACCGCATTTATAAATGG
TCTATTAGCCTTCAATCATACTGCCTAATAATTATTTGAAGGAAGTCTTTGATGTCAGTGGCCC
ATATATGCATTCAAACCGTGAGCAATTTCCTGTGGTAATATGTGGCGAATTTGCTCTTATATTT
GTAAGGATTATTCATCTATAAACACCTGCTACTTGCA

hide sequence

RefSeq Acc Id:

XM_008760719 ⟹ XP_008758941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	43,353,822 - 43,577,226 (-)	NCBI
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI

Sequence:

show sequence

GAGTAGGGGAGGGGCTGCCTGGCGCTGGTGCCCCTGGCACTTCCTAGGAGACTCACAGCCCTTT
CTTTGCAGCTGTCACTAGAAGACTTCTGGGTTTCCCTCTGGAAGAAAGCCTCCCATCTAAGCCT
GCTGCCCTTCCATCCCTTATTCGCTCTCTGCAAACCGCTCCTCCAAGCCTTTCCATTGTGCTCT
GCCTCCAGCATAAGACCTTCACCTCCTTTGTAGTGGGGAGACTTACTTGAGGCTCTCTGAACCT
CCGGCTGCAATGGAGCTGTATGGAAAGATGGCCTCGGCACAAGATGCCAGGTTTGGTCAGAAAG
ACTCTTCTGACCAGAACTTCGACTACATGTTCAAGTTGCTGATCATTGGCAATAGCAGCGTGGG
CAAAACATCCTTCCTGTTCCGCTATGCTGATGACTCCTTCACGTCCGCCTTTGTCAGCACGGTC
GGCATCGATTTCAAAGTAAAAACTGTCTTCAAAAATGAAAAGAGAATCAAGCTTCAGATTTGGG
ACACAGCAGGCCAGGAAAGATACAGGACCATCACCACAGCCTATTATCGAGGGGCCATGGGCTT
CATTTTAATGTATGACATCACAAATGAAGAATCCTTCAACGCTGTACAAGATTGGTCAACTCAG
ATCAAAACATATTCCTGGGATAATGCCCAGGTTATCCTGGCCGGAAACAAATGTGACATGGAAG
ACGAACGGGTGGTCTCAACTGAGAGAGGGCAGCGCTTAGGAGAGCAGCTCGGGTTTGAGTTTTT
TGAAACCAGCGCCAAGGATAACATCAACGTGAAGCAAACCTTTGAGCGCCTCGTAGATATCATC
TGTGACAAAATGTCAGAGAGCTTGGAGACTGACCCAGCCATCACAGCCGCCAAGCAGAGCACGA
GGCTCAAGGAAACCCCTCCTCCACCACAGCCCAACTGTGGCTGCTAATGTCCCCCCGCACAGGA
GCTCCAAGGGGCTCCAGAGCAGCCAAGAAACAGCATTTATAAATGGTCTATTAGCCTTCAATCA
TACTGCCTAATAATTATTTGAAGGAAGTCTTTGATGTCAGTGGCCCATATATGCATTCAAACCA
TGAGCAATTTCCTGTGGTAATATGTGGCGAATTTGCTCTTATATTTGTAAGGATTATTCATCTA
TAAACACCTGCTACTTGCA

hide sequence

RefSeq Acc Id:

XM_039101613 ⟹ XP_038957541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	43,353,822 - 43,575,271 (-)	NCBI
mRatBN7.2	2	41,627,720 - 41,841,900 (-)	NCBI

RefSeq Acc Id:

XM_063281218 ⟹ XP_063137288

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	43,353,822 - 43,560,175 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001420760	(Get FASTA)	NCBI Sequence Viewer
	NP_598220	(Get FASTA)	NCBI Sequence Viewer
	XP_008758941	(Get FASTA)	NCBI Sequence Viewer
	XP_038957541	(Get FASTA)	NCBI Sequence Viewer
	XP_063137288	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52704	(Get FASTA)	NCBI Sequence Viewer
	AAC52879	(Get FASTA)	NCBI Sequence Viewer
	BAA11302	(Get FASTA)	NCBI Sequence Viewer
	EDM10329	(Get FASTA)	NCBI Sequence Viewer
	EDM10330	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015871
	ENSRNOP00000096986
	ENSRNOP00000096986.1
	ENSRNOP00000104946
GenBank Protein	P62824	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598220 ⟸ NM_133536

- UniProtKB:

P62824 (UniProtKB/Swiss-Prot), A0A8L2R781 (UniProtKB/TrEMBL), A6I5M2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVG
IDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVILVGNKCDMEDERVVSTERGRHLGEQLGFEFFETSAKDNINVKQTFERLVDIIC
DKMSESLETDPAITGAKQSTRLKETPPPPQPNCGC

hide sequence

RefSeq Acc Id:

XP_008758941 ⟸ XM_008760719

- Peptide Label:

isoform X2

- Sequence:

show sequence

MELYGKMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGID
FKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKT
YSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDK
MSESLETDPAITAAKQSTRLKETPPPPQPNCGC

hide sequence

Ensembl Acc Id:

ENSRNOP00000015871 ⟸ ENSRNOT00000015871

Ensembl Acc Id:

ENSRNOP00000073277 ⟸ ENSRNOT00000086851

RefSeq Acc Id:	XP_038957541 ⟸ XM_039101613
- Peptide Label:	isoform X1
- UniProtKB:	P62824 (UniProtKB/Swiss-Prot), A6I5M2 (UniProtKB/TrEMBL), A0A8L2R781 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000096986 ⟸ ENSRNOT00000116600

Ensembl Acc Id:

ENSRNOP00000094469 ⟸ ENSRNOT00000118628

RefSeq Acc Id:	XP_063137288 ⟸ XM_063281218
- Peptide Label:	isoform X3
- UniProtKB:	A0A8L2R781 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000104946 ⟸ ENSRNOT00000170596

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62824-F1-model_v2	AlphaFold	P62824	1-227	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620923	AgrOrtholog
BioCyc Gene	G2FUF-54437	BioCyc
Ensembl Genes	ENSRNOG00000011623	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015871	ENTREZGENE
	ENSRNOT00000116600	ENTREZGENE
	ENSRNOT00000116600.1	UniProtKB/Swiss-Prot
	ENSRNOT00000170596	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab3	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
	Small_GTPase_Rab	UniProtKB/Swiss-Prot
KEGG Report	rno:171058	UniProtKB/Swiss-Prot
NCBI Gene	171058	ENTREZGENE
PANTHER	LD44762P	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab3c	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011623	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I6AM94_RAT	UniProtKB/TrEMBL
	A0A8L2Q7P7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2R781	ENTREZGENE, UniProtKB/TrEMBL
	A6I5M1	ENTREZGENE, UniProtKB/TrEMBL
	A6I5M2	ENTREZGENE, UniProtKB/TrEMBL
	P62824	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q62858	UniProtKB/Swiss-Prot
	Q62974	UniProtKB/Swiss-Prot
	Q63482	UniProtKB/Swiss-Prot
	Q9CXQ1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Rab3c	RAB3C, member RAS oncogene family			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Rab3c	RAB3C, member RAS oncogene family			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar