Advanced Search (OLGA)

Gene: Khdrbs3 (KH RNA binding domain containing, signal transduction associated 3) Rattus norvegicus

Analyze

Symbol:

Khdrbs3

Name:

KH RNA binding domain containing, signal transduction associated 3

RGD ID:

620921

Description:

Enables single-stranded RNA binding activity. Involved in mRNA processing; regulation of RNA splicing; and spermatogenesis. Located in nucleus. Orthologous to human KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Etle; etoile, Sam68-like protein SLM-2; KH domain containing, RNA binding, signal transduction associated 3; KH domain-containing, RNA-binding, signal transduction-associated protein 3; rSLM-2; sam68-like mammalian protein 2; SLM-2; Slm2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	102,726,628 - 102,884,545 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	102,726,843 - 102,884,541 (+)	Ensembl				GRCr8
mRatBN7.2	7	100,837,707 - 100,995,644 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	100,837,934 - 100,988,460 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	102,574,664 - 102,718,063 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	104,776,349 - 104,919,747 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	104,717,109 - 104,860,445 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	110,031,819 - 110,179,475 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	110,031,696 - 110,179,468 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	109,965,269 - 110,111,230 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	106,539,015 - 106,614,745 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	97,331,783 - 97,474,062 (+)	NCBI		Celera
RGSC_v3.1	7	106,573,244 - 106,648,972 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

deguelin (ISO)

deoxynivalenol (ISO)

diethyl maleate (ISO)

dimethylarsinic acid (EXP)

dioxygen (ISO)

disulfiram (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furan (EXP)

glycine betaine (EXP)

ivermectin (ISO)

lead(0) (ISO)

leflunomide (ISO)

maneb (ISO)

methotrexate (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triptonide (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

mRNA processing (IDA)

positive regulation of RNA splicing (IMP)

regulation of alternative mRNA splicing, via spliceosome (IBA,IDA)

regulation of mRNA splicing, via spliceosome (IEA,ISO)

spermatogenesis (IEP)

Cellular Component

nucleoplasm (ISO)

nucleus (IBA,IDA,IEA,ISO)

protein-containing complex (ISO)

Molecular Function

identical protein binding (ISO)

mRNA binding (IBA)

nucleic acid binding (IEA)

protein binding (IPI,ISO)

protein domain specific binding (ISO)

RNA binding (IEA,ISO,ISS)

SH3 domain binding (IEA)

single-stranded RNA binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.	Heinrich B, etal., J Biol Chem. 2009 May 22;284(21):14303-15. Epub 2009 Mar 12.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	The STAR/GSG family protein rSLM-2 regulates the selection of alternative splice sites.	Stoss O, etal., J Biol Chem 2001 Mar 23;276(12):8665-73.
9.	p59(fyn)-mediated phosphorylation regulates the activity of the tissue-specific splicing factor rSLM-1.	Stoss O, etal., Mol Cell Neurosci 2004 Sep;27(1):8-21.
10.	T-STAR/ETOILE: a novel relative of SAM68 that interacts with an RNA-binding protein implicated in spermatogenesis.	Venables JP, etal., Hum Mol Genet. 1999 Jun;8(6):959-69.

Additional References at PubMed

PMID:10749975	PMID:19561594	PMID:22196734	PMID:22681889

Genomics

Comparative Map Data

Khdrbs3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	102,726,628 - 102,884,545 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	102,726,843 - 102,884,541 (+)	Ensembl				GRCr8
mRatBN7.2	7	100,837,707 - 100,995,644 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	100,837,934 - 100,988,460 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	102,574,664 - 102,718,063 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	104,776,349 - 104,919,747 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	104,717,109 - 104,860,445 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	110,031,819 - 110,179,475 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	110,031,696 - 110,179,468 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	109,965,269 - 110,111,230 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	106,539,015 - 106,614,745 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	97,331,783 - 97,474,062 (+)	NCBI		Celera
RGSC_v3.1	7	106,573,244 - 106,648,972 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

KHDRBS3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	135,457,456 - 135,656,516 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	135,457,456 - 135,656,722 (+)	Ensembl			hg38	GRCh38
GRCh37	8	136,469,699 - 136,659,853 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	136,538,898 - 136,729,031 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	136,538,897 - 136,729,028	NCBI
Celera	8	132,642,482 - 132,831,891 (+)	NCBI		Celera
Cytogenetic Map	8	q24.23	NCBI
HuRef	8	131,785,096 - 131,974,740 (+)	NCBI		HuRef
CHM1_1	8	136,511,650 - 136,701,600 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	136,575,311 - 136,774,451 (+)	NCBI		T2T-CHM13v2.0

Khdrbs3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	68,800,155 - 68,973,064 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	68,800,269 - 68,973,060 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	68,928,392 - 69,101,794 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	68,928,420 - 69,101,211 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	68,758,850 - 68,923,949 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	68,758,089 - 68,923,188 (+)	NCBI		MGSCv36	mm8
Celera	15	70,448,119 - 70,614,372 (+)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	30.36	NCBI

Khdrbs3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955461	9,751,057 - 9,915,943 (+)	Ensembl
ChiLan1.0	NW_004955461	9,751,057 - 9,926,211 (+)	NCBI	ChiLan1.0	ChiLan1.0

KHDRBS3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	152,848,167 - 153,047,670 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	128,381,719 - 128,580,807 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	132,131,953 - 132,331,310 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	135,084,505 - 135,282,770 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	135,084,505 - 135,282,766 (+)	Ensembl			panPan2	panpan1.1

KHDRBS3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	31,397,501 - 31,583,198 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	31,392,842 - 31,605,257 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	31,374,685 - 31,559,991 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	31,768,586 - 31,954,402 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	31,763,092 - 31,954,398 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	31,490,283 - 31,675,703 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	31,584,104 - 31,769,857 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	31,934,428 - 32,120,024 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Khdrbs3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	6,806,218 - 6,977,811 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	14,239,841 - 14,403,916 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	14,232,114 - 14,403,910 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KHDRBS3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	6,282,076 - 6,446,389 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	6,289,577 - 6,446,494 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	6,127,960 - 6,284,514 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KHDRBS3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	129,814,228 - 130,044,479 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	129,911,686 - 130,035,258 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	10,035,579 - 10,236,195 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Khdrbs3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	20,425,148 - 20,586,626 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624735	20,415,996 - 20,586,632 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Khdrbs3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	242,348,296 - 242,497,980 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Khdrbs3
1521 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	62
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000012753
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
1331723	Bw25	Body weight QTL 25	3.348		body mass (VT:0001259)	body weight (CMO:0000012)	7	96700404	111672180	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

D7Rat100

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	102,754,898 - 102,755,095 (+)	Marker Load Pipeline
mRatBN7.2	7	100,865,992 - 100,866,189 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	110,056,517 - 110,056,713	NCBI	Rnor6.0
Rnor_5.0	7	109,990,044 - 109,990,240	UniSTS	Rnor5.0
Celera	7	97,353,709 - 97,353,923	UniSTS
RH 3.4 Map	7	693.3	UniSTS
RH 3.4 Map	7	693.3	RGD
RH 2.0 Map	7	526.5	RGD
SHRSP x BN Map	7	56.84	RGD
FHH x ACI Map	7	47.8299	RGD
Cytogenetic Map	7	q34	UniSTS

D7Rat53

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	100,874,472 - 100,874,685 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	110,065,540 - 110,065,752	NCBI	Rnor6.0
Rnor_5.0	7	109,998,231 - 109,998,443	UniSTS	Rnor5.0
Celera	7	97,362,214 - 97,362,426	UniSTS
RH 3.4 Map	7	693.3	UniSTS
RH 3.4 Map	7	693.3	RGD
RH 2.0 Map	7	533.9	RGD
FHH x ACI Map	7	47.8299	RGD
Cytogenetic Map	7	q34	UniSTS

D7Rat159

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	102,852,489 - 102,852,609 (+)	Marker Load Pipeline
mRatBN7.2	7	100,963,583 - 100,963,703 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	110,154,795 - 110,154,914	NCBI	Rnor6.0
Rnor_5.0	7	110,086,417 - 110,086,536	UniSTS	Rnor5.0
RGSC_v3.4	7	106,587,928 - 106,588,048	RGD	RGSC3.4
RGSC_v3.4	7	106,587,929 - 106,588,048	UniSTS	RGSC3.4
RGSC_v3.1	7	106,622,158 - 106,622,278	RGD
FHH x ACI Map	7	47.8299	UniSTS
FHH x ACI Map	7	47.8299	RGD
Cytogenetic Map	7	q34	UniSTS

BE119914

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	100,839,897 - 100,840,061 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	110,033,656 - 110,033,819	NCBI	Rnor6.0
Rnor_5.0	7	109,967,106 - 109,967,269	UniSTS	Rnor5.0
Celera	7	97,333,669 - 97,333,832	UniSTS
RH 3.4 Map	7	695.1	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	68	59	6	331	168	11	143	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005486718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010053039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF152547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012753 ⟹ ENSRNOP00000012753

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,726,843 - 102,877,371 (+)	Ensembl
mRatBN7.2 Ensembl	7	100,837,934 - 100,988,460 (+)	Ensembl
Rnor_6.0 Ensembl	7	110,031,696 - 110,179,468 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097337 ⟹ ENSRNOP00000096934

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,726,909 - 102,884,541 (+)	Ensembl
mRatBN7.2 Ensembl	7	100,837,934 - 100,988,460 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112404 ⟹ ENSRNOP00000076402

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,727,477 - 102,877,365 (+)	Ensembl
mRatBN7.2 Ensembl	7	100,838,339 - 100,988,460 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151110 ⟹ ENSRNOP00000098672

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,726,909 - 102,884,541 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162056 ⟹ ENSRNOP00000099220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,726,909 - 102,884,541 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162204 ⟹ ENSRNOP00000110818

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	102,726,909 - 102,884,541 (+)	Ensembl

RefSeq Acc Id:

NM_022249 ⟹ NP_071585

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,726,843 - 102,877,372 (+)	NCBI
mRatBN7.2	7	100,837,934 - 100,988,467 (+)	NCBI
Rnor_6.0	7	110,031,819 - 110,179,475 (+)	NCBI
Rnor_5.0	7	109,965,269 - 110,111,230 (+)	NCBI
RGSC_v3.4	7	106,539,015 - 106,614,745 (+)	RGD
Celera	7	97,331,783 - 97,474,062 (+)	RGD

Sequence:

show sequence

CGGCTTGGCCGCCGAGGCGCCTGGCGGGGTCCGCGCCGCCGCGGGCGGGCGGCTCGGGCTGCGG
GGCGGCTGGCGCGCGCGCGCCTCGGGGCGGAGAAGCGGGCCCGGCGGCCGGCGAGCATGGAGGA
GAAGTACCTGCCGGAGCTGATGGCGGAGAAGGACTCTCTGGACCCCTCCTTCACGCACGCCCTG
CGCTTGGTGAACCGAGAAATAGAAAAGTTTCAGAAGGGAGAAGCCAAGGATGAAGAGAAGTACA
TTGATGTGGTGATAAACAAGAACATGAAGCTGGGACAGAAAGTGTTGATTCCTGTAAAGCAGTT
TCCCAAGTTCAACTTTGTGGGGAAGCTTTTGGGTCCACGTGGCAATTCCCTGAAGCGCTTACAA
GAAGAAACGTTGACAAAAATGTCCATCCTTGGCAAAGGTTCCATGAGAGACAAGGCAAAGGAGG
AGGAGCTGAGGAAAAGTGGAGAAGCGAAGTACTTTCACCTCAATGACGACCTGCACGTGCTCAT
TGAAGTGTTCGCGCCCCCAGCGGAAGCTTATGCCCGGATGGGGCATGCCTTGGAAGACATTAAG
AAGTTCCTGATCCCTGACTATAATGATGAAATCAGGCAAGCACAGCTCCAGGAATTAACTTATT
TGAATGGAGGTTCAGAAAATGCAGATGTCCCAGTGGTTCGAGGGAAATCAACTTTGCGTACGAG
AGGTGTAACGACACCAGCAATAACCAGGGGAAGAGGAGGAGTCACAGCCAGGCCTGTTGCAGTT
GGGGTACCACGTGGGACACCGACTCCCCGAGGAGTCCTTTCCACCCGAGGGCCAGTGAGCCGGG
GAAGAGGACTTCTCACTCCCAGAGCAAGAGGTGTCCCCCCAACTGGATACAGACCTCCACCGCC
ACCCCCAACACAGGAGACCTATGGAGAGTATGACTATGACGATGGGTACAGTACAGCATATGAT
GACCAGAGCTACGACTCCTATGACAACAGCTACAGCACCCCAGCACAAAGCGGAGCGGATTACT
ATGATTACGGGCATGGACTCGGCGAGGAGGCTTATGATTCCTATGGGCAAGAGGACTGGACTAA
CTCAAGACATAAGGCTCCTTCGGCGAGGACAGCGAAGGGCGTCTACAGAGAGCAGCCATATGGC
AGATACTGACTGTACTGTCTGATGTTGTGAAATAGCCAATCTCCACCGTCCTGTATACTGTTCA
AAGTAATTGTTTTCTATGACCAATCCCTTTTTAAATAAATCAAAATGCTTAAAATCTGAACGGA
TGGAACTTAAAGCCACTTTGTTGAAGCATCCACTTGGCAGGGAGAAGAAGGACATGTAAAATTT
TGTTATTTGCAGTCTGTATATGAAAGCTAGGTTATGAAAAGGAAAAAAATAACTTTGATTAACT
AGTGTTAAACAAAAAGATAGGTTTACTAAATATGTTAATCCATTCTTTAACATAAGCCTCACCT
TTCATTTTAAAGGTTTCCATAGAATTTAGTTATTTTATCTTTCAGCCATATGCTAGTTTTTTTT
TCTTTCTTTCTTTCTTTCTTGCCAACTTGCGTGAAAAGGGAGCCAATTACAAGTGCAGACAATG
TGGTTTCTTTTGTAACTGAGTCCTGAAATGTTCTGTAGTGTTAGGCAAAGTCTCCTCTTGCTTG
ATACTAAATAAACTTTTGAAAGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063264202 ⟹ XP_063120272

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,756,629 - 102,877,372 (+)	NCBI

RefSeq Acc Id:

XM_063264203 ⟹ XP_063120273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,762,422 - 102,877,372 (+)	NCBI

RefSeq Acc Id:

XM_063264204 ⟹ XP_063120274

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,727,433 - 102,877,372 (+)	NCBI

RefSeq Acc Id:

XR_005486718

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,726,628 - 102,884,545 (+)	NCBI
mRatBN7.2	7	100,837,707 - 100,995,644 (+)	NCBI

RefSeq Acc Id:

XR_010053039

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	102,727,525 - 102,884,545 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071585	(Get FASTA)	NCBI Sequence Viewer
	XP_063120272	(Get FASTA)	NCBI Sequence Viewer
	XP_063120273	(Get FASTA)	NCBI Sequence Viewer
	XP_063120274	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF73222	(Get FASTA)	NCBI Sequence Viewer
	EDM16130	(Get FASTA)	NCBI Sequence Viewer
	EDM16131	(Get FASTA)	NCBI Sequence Viewer
	EDM16132	(Get FASTA)	NCBI Sequence Viewer
	EDM16133	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012753
	ENSRNOP00000076402
GenBank Protein	Q9JLP1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071585 ⟸ NM_022249

- UniProtKB:

Q9JLP1 (UniProtKB/Swiss-Prot), F1LMN8 (UniProtKB/TrEMBL), A6HRU0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEKYLPELMAEKDSLDPSFTHALRLVNREIEKFQKGEAKDEEKYIDVVINKNMKLGQKVLIPV
KQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLH
VLIEVFAPPAEAYARMGHALEDIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTL
RTRGVTTPAITRGRGGVTARPVAVGVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRP
PPPPPTQETYGEYDYDDGYSTAYDDQSYDSYDNSYSTPAQSGADYYDYGHGLGEEAYDSYGQED
WTNSRHKAPSARTAKGVYREQPYGRY

hide sequence

Ensembl Acc Id:

ENSRNOP00000012753 ⟸ ENSRNOT00000012753

Ensembl Acc Id:

ENSRNOP00000096934 ⟸ ENSRNOT00000097337

Ensembl Acc Id:

ENSRNOP00000076402 ⟸ ENSRNOT00000112404

RefSeq Acc Id:	XP_063120274 ⟸ XM_063264204
- Peptide Label:	isoform X3
- UniProtKB:	Q9JLP1 (UniProtKB/Swiss-Prot), A0A8I5YBJ1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120272 ⟸ XM_063264202
- Peptide Label:	isoform X1
- UniProtKB:	Q9JLP1 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063120273 ⟸ XM_063264203
- Peptide Label:	isoform X2
- UniProtKB:	Q9JLP1 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000099220 ⟸ ENSRNOT00000162056

Ensembl Acc Id:

ENSRNOP00000098672 ⟸ ENSRNOT00000151110

Ensembl Acc Id:

ENSRNOP00000110818 ⟸ ENSRNOT00000162204

Protein Domains

K Homology KH KHDRBS Qua1 Sam68 tyrosine-rich

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JLP1-F1-model_v2	AlphaFold	Q9JLP1	1-346	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620921	AgrOrtholog
BioCyc Gene	G2FUF-33092	BioCyc
Ensembl Genes	ENSRNOG00000009539	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000012753	ENTREZGENE
	ENSRNOT00000097337	ENTREZGENE
	ENSRNOT00000112404	ENTREZGENE
Gene3D-CATH	3.30.1370.10	UniProtKB/Swiss-Prot
InterPro	BBP-like	UniProtKB/Swiss-Prot
	KH_1_KHDC4/BBP-like	UniProtKB/Swiss-Prot
	KH_dom	UniProtKB/Swiss-Prot
	KH_dom_type_1_sf	UniProtKB/Swiss-Prot
	Qua1_dom	UniProtKB/Swiss-Prot
	Sam68-YY	UniProtKB/Swiss-Prot
KEGG Report	rno:64015	UniProtKB/Swiss-Prot
NCBI Gene	64015	ENTREZGENE
PANTHER	KH DOMAIN-CONTAINING, RNA-BINDING, SIGNAL TRANSDUCTION-ASSOCIATED PROTEIN 3	UniProtKB/Swiss-Prot
	PTHR11208	UniProtKB/Swiss-Prot
Pfam	KH-I_KHDC4-BBP	UniProtKB/Swiss-Prot
	Qua1	UniProtKB/Swiss-Prot
	Sam68-YY	UniProtKB/Swiss-Prot
PharmGKB	KHDRBS3	RGD
PhenoGen	Khdrbs3	PhenoGen
RatGTEx	ENSRNOG00000009539	RatGTEx
SMART	SM00322	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54791	UniProtKB/Swiss-Prot
UniProt	A0A8I5YBJ1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AMW6_RAT	UniProtKB/TrEMBL
	A0ABK0LBZ8_RAT	UniProtKB/TrEMBL
	A0ABK0LCY0_RAT	UniProtKB/TrEMBL
	A0ABK0LYH5_RAT	UniProtKB/TrEMBL
	A6HRU0	ENTREZGENE, UniProtKB/TrEMBL
	A6HRU1_RAT	UniProtKB/TrEMBL
	A6HRU2_RAT	UniProtKB/TrEMBL
	F1LMN8	ENTREZGENE, UniProtKB/TrEMBL
	KHDR3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-01	Khdrbs3	KH RNA binding domain containing, signal transduction associated 3	Khdrbs3	KH domain containing, RNA binding, signal transduction associated 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Khdrbs3	KH domain containing, RNA binding, signal transduction associated 3		etoile, Sam68-like protein SLM-2	Name updated	1299863	APPROVED
2004-09-10	Khdrbs3	etoile, Sam68-like protein SLM-2	Etle		Symbol and Name updated	1299863	APPROVED
2002-08-07	Etle	etoile, Sam68-like protein SLM-2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the STAR (signal transduction and activation of RNA) protein family	632715

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message