Symbol:
Slc34a2
Name:
solute carrier family 34 member 2
RGD ID:
620889
Description:
Enables protein domain specific binding activity and sodium:phosphate symporter activity. Involved in response to estradiol; response to fructose; and sodium-dependent phosphate transport. Located in apical plasma membrane; brush border membrane; and microvillus membrane. Human ortholog(s) of this gene implicated in pulmonary alveolar microlithiasis. Orthologous to human SLC34A2 (solute carrier family 34 member 2); PARTICIPATES IN phosphate transport pathway; INTERACTS WITH 1,3-dinitrobenzene; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
na(+)-dependent phosphate cotransporter 2B; na(+)/Pi cotransporter 2B; naPi-2b; rNaPi IIb; sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; sodium/phosphate cotransporter 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; type IIb sodium-phosphate transporter
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC34A2 (solute carrier family 34 member 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc34a2 (solute carrier family 34 (sodium phosphate), member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc34a2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC34A2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC34A2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc34a2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC34A2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC34A2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc34a2 (solute carrier family 34 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DNAH14 (dynein axonemal heavy chain 14) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SLC34A2 (solute carrier family 34 member 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc34a2 (solute carrier family 34 (sodium phosphate), member 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc34a2a (solute carrier family 34 member 2a)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZK563.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc34a2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 62,123,313 - 62,153,020 (-) NCBI GRCr8 mRatBN7.2 14 57,910,931 - 57,930,236 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 57,910,480 - 57,930,436 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 62,312,729 - 62,331,995 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 63,631,450 - 63,650,714 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 60,028,211 - 60,047,475 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 60,257,211 - 60,276,516 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 60,256,712 - 60,276,794 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 60,375,980 - 60,395,841 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 62,660,006 - 62,679,311 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 62,661,945 - 62,674,066 (-) NCBI Celera 14 57,011,613 - 57,030,915 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc34a2 Rat 1,2-dimethylhydrazine decreases expression ISO Slc34a2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC34A2 mRNA CTD PMID:22206623 Slc34a2 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of SLC34A2 mRNA CTD PMID:21983209 Slc34a2 Rat 17alpha-ethynylestradiol increases expression ISO Slc34a2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SLC34A2 mRNA CTD PMID:12072388 Slc34a2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SLC34A2 mRNA CTD PMID:26496021 Slc34a2 Rat 17beta-estradiol increases expression ISO Slc34a2 (Mus musculus) 6480464 Estradiol results in increased expression of SLC34A2 mRNA CTD PMID:39298647 Slc34a2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SLC34A2 mRNA CTD PMID:32145629 Slc34a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC34A2 mRNA CTD PMID:21215274 Slc34a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc34a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC34A2 mRNA CTD PMID:26377647 and PMID:28922406 Slc34a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of SLC34A2 mRNA CTD PMID:25975270 Slc34a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of SLC34A2 mRNA] CTD PMID:21215274 Slc34a2 Rat 4-hydroxyphenyl retinamide increases expression ISO Slc34a2 (Mus musculus) 6480464 Fenretinide results in increased expression of SLC34A2 mRNA CTD PMID:28973697 Slc34a2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SLC34A2 mRNA CTD PMID:31881176 Slc34a2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of SLC34A2 mRNA CTD PMID:20488242 Slc34a2 Rat all-trans-retinoic acid multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SLC34A2 mRNA CTD PMID:36189433 Slc34a2 Rat all-trans-retinoic acid affects expression ISO SLC34A2 (Homo sapiens) 6480464 Tretinoin affects the expression of SLC34A2 mRNA CTD PMID:31600526 Slc34a2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SLC34A2 mRNA CTD PMID:35163327 Slc34a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC34A2 mRNA CTD PMID:16483693 Slc34a2 Rat aristolochic acid A decreases expression ISO SLC34A2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SLC34A2 mRNA CTD PMID:33212167 Slc34a2 Rat arsane increases transport ISO SLC34A2 (Homo sapiens) 6480464 SLC34A2 protein results in increased transport of Arsenic CTD PMID:22214486 Slc34a2 Rat arsenic atom increases transport ISO SLC34A2 (Homo sapiens) 6480464 SLC34A2 protein results in increased transport of Arsenic CTD PMID:22214486 Slc34a2 Rat Azoxymethane multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC34A2 mRNA CTD PMID:29950665 Slc34a2 Rat benzo[a]pyrene increases methylation ISO SLC34A2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC34A2 exon and Benzo(a)pyrene results in increased methylation of SLC34A2 promoter CTD PMID:27901495 Slc34a2 Rat benzo[a]pyrene affects methylation ISO SLC34A2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC34A2 5' UTR CTD PMID:27901495 Slc34a2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of SLC34A2 mRNA CTD PMID:18164116 Slc34a2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SLC34A2 mRNA CTD PMID:26496021 Slc34a2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC34A2 mRNA CTD PMID:35192832 Slc34a2 Rat bisphenol A increases methylation ISO SLC34A2 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SLC34A2 gene CTD PMID:31601247 Slc34a2 Rat bisphenol A increases expression ISO Slc34a2 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC34A2 mRNA CTD PMID:32156529 and PMID:34585602 Slc34a2 Rat bisphenol A increases expression ISO SLC34A2 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC34A2 mRNA CTD PMID:29275510 Slc34a2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SLC34A2 gene CTD PMID:28505145 Slc34a2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC34A2 mRNA CTD PMID:25181051 more ... Slc34a2 Rat bisphenol A decreases expression ISO Slc34a2 (Mus musculus) 6480464 bisphenol A results in decreased expression of SLC34A2 mRNA CTD PMID:26063408 Slc34a2 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of SLC34A2 mRNA CTD PMID:32479839 Slc34a2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat calcitriol increases expression ISO SLC34A2 (Homo sapiens) 6480464 Calcitriol results in increased expression of SLC34A2 mRNA CTD PMID:26485663 Slc34a2 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of SLC34A2 mRNA CTD PMID:30744511 Slc34a2 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of SLC34A2 mRNA CTD PMID:12851107 and PMID:32741897 Slc34a2 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of SLC34A2 mRNA CTD PMID:21865292 Slc34a2 Rat dextran sulfate multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC34A2 mRNA CTD PMID:29950665 Slc34a2 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of SLC34A2 mRNA CTD PMID:23153324 Slc34a2 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of SLC34A2 mRNA CTD PMID:32341500 Slc34a2 Rat dimethylarsinic acid multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC34A2 mRNA CTD PMID:34876320 Slc34a2 Rat dioxygen multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SLC34A2 mRNA CTD PMID:30529165 Slc34a2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SLC34A2 mRNA CTD PMID:29391264 Slc34a2 Rat ethylparaben increases expression ISO SLC34A2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of SLC34A2 mRNA CTD PMID:37690743 Slc34a2 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of SLC34A2 mRNA CTD PMID:32741897 Slc34a2 Rat fentin chloride decreases expression EXP 6480464 triphenyltin chloride results in decreased expression of SLC34A2 mRNA CTD PMID:37156404 Slc34a2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SLC34A2 mRNA CTD PMID:24793618 Slc34a2 Rat fonofos increases methylation ISO SLC34A2 (Homo sapiens) 6480464 Fonofos results in increased methylation of SLC34A2 promoter CTD PMID:22847954 Slc34a2 Rat formaldehyde increases expression ISO SLC34A2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SLC34A2 mRNA CTD PMID:27905399 Slc34a2 Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of SLC34A2 mRNA CTD PMID:18400728 Slc34a2 Rat fructose multiple interactions EXP 6480464 tungstate promotes the reaction [Fructose results in decreased expression of SLC34A2 mRNA] and Vanadates promotes the reaction [Fructose results in decreased expression of SLC34A2 mRNA] CTD PMID:18400728 Slc34a2 Rat fructose affects expression EXP 6480464 Fructose affects the expression of SLC34A2 mRNA CTD PMID:15150374 Slc34a2 Rat fulvestrant increases methylation ISO SLC34A2 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of SLC34A2 gene CTD PMID:31601247 Slc34a2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of SLC34A2 mRNA CTD PMID:26194646 Slc34a2 Rat heptachlor decreases expression EXP 6480464 Heptachlor results in decreased expression of SLC34A2 mRNA CTD PMID:23153324 Slc34a2 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of SLC34A2 mRNA CTD PMID:21396975 Slc34a2 Rat iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of SLC34A2 mRNA CTD PMID:16629162 Slc34a2 Rat iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of SLC34A2 mRNA CTD PMID:16629162 Slc34a2 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat methotrexate decreases expression ISO SLC34A2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of SLC34A2 mRNA CTD PMID:24449571 Slc34a2 Rat methylarsonic acid multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC34A2 mRNA CTD PMID:34876320 Slc34a2 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of SLC34A2 mRNA CTD PMID:30744511 Slc34a2 Rat mirex decreases expression EXP 6480464 Mirex results in decreased expression of SLC34A2 mRNA CTD PMID:23153324 Slc34a2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SLC34A2 mRNA CTD PMID:36189433 Slc34a2 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of SLC34A2 mRNA CTD PMID:21515302 Slc34a2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of SLC34A2 mRNA CTD PMID:18164116 Slc34a2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat nevirapine decreases expression EXP 6480464 Nevirapine metabolite results in decreased expression of SLC34A2 mRNA CTD PMID:23947594 Slc34a2 Rat nickel atom increases expression ISO SLC34A2 (Homo sapiens) 6480464 Nickel results in increased expression of SLC34A2 mRNA CTD PMID:24768652 and PMID:25583101 Slc34a2 Rat nickel sulfate decreases expression ISO Slc34a2 (Mus musculus) 6480464 nickel sulfate results in decreased expression of SLC34A2 mRNA CTD PMID:16100012 Slc34a2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of SLC34A2 mRNA CTD PMID:33484710 Slc34a2 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of SLC34A2 mRNA CTD PMID:23439660 Slc34a2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SLC34A2 mRNA CTD PMID:30723492 Slc34a2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SLC34A2 mRNA CTD PMID:32680482 Slc34a2 Rat parathion increases methylation ISO SLC34A2 (Homo sapiens) 6480464 Parathion results in increased methylation of SLC34A2 promoter CTD PMID:22847954 Slc34a2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SLC34A2 mRNA CTD PMID:35163327 Slc34a2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of SLC34A2 mRNA CTD PMID:28511854 Slc34a2 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of SLC34A2 mRNA CTD PMID:31324951 Slc34a2 Rat phenobarbital affects expression ISO Slc34a2 (Mus musculus) 6480464 Phenobarbital affects the expression of SLC34A2 mRNA CTD PMID:23091169 Slc34a2 Rat pirinixic acid decreases expression ISO Slc34a2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC34A2 mRNA CTD PMID:17426115 Slc34a2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of SLC34A2 mRNA CTD PMID:32741897 Slc34a2 Rat pirinixic acid increases expression ISO Slc34a2 (Mus musculus) 6480464 pirinixic acid results in increased expression of SLC34A2 mRNA CTD PMID:20813756 Slc34a2 Rat pravastatin decreases expression ISO Slc34a2 (Mus musculus) 6480464 Pravastatin results in decreased expression of SLC34A2 mRNA CTD PMID:27225895 Slc34a2 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of SLC34A2 mRNA CTD PMID:27225895 Slc34a2 Rat propiconazole increases expression ISO Slc34a2 (Mus musculus) 6480464 propiconazole results in increased expression of SLC34A2 mRNA CTD PMID:21278054 Slc34a2 Rat prothioconazole increases expression ISO SLC34A2 (Homo sapiens) 6480464 prothioconazole results in increased expression of SLC34A2 mRNA CTD PMID:35048155 Slc34a2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of SLC34A2 mRNA CTD PMID:28374803 Slc34a2 Rat sodium arsenate multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC34A2 mRNA CTD PMID:34876320 Slc34a2 Rat sodium arsenite multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of SLC34A2 mRNA CTD PMID:34876320 Slc34a2 Rat sodium arsenite decreases expression ISO Slc34a2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SLC34A2 mRNA CTD PMID:37682722 Slc34a2 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of SLC34A2 mRNA CTD PMID:21865292 Slc34a2 Rat tamoxifen increases expression ISO Slc34a2 (Mus musculus) 6480464 Tamoxifen results in increased expression of SLC34A2 mRNA CTD PMID:25123088 Slc34a2 Rat tamoxifen affects expression ISO Slc34a2 (Mus musculus) 6480464 Tamoxifen affects the expression of SLC34A2 mRNA CTD PMID:20937368 Slc34a2 Rat terbufos increases methylation ISO SLC34A2 (Homo sapiens) 6480464 terbufos results in increased methylation of SLC34A2 promoter CTD PMID:22847954 Slc34a2 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of SLC34A2 mRNA CTD PMID:21515302 Slc34a2 Rat testosterone multiple interactions ISO Slc34a2 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Slc34a2 Rat testosterone increases expression ISO Slc34a2 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of SLC34A2 mRNA CTD PMID:33848595 Slc34a2 Rat tetrachloroethene decreases expression ISO Slc34a2 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of SLC34A2 mRNA CTD PMID:28973375 Slc34a2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SLC34A2 protein CTD PMID:17544377 Slc34a2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLC34A2 mRNA CTD PMID:23411599 and PMID:34492290 Slc34a2 Rat titanium dioxide increases expression ISO Slc34a2 (Mus musculus) 6480464 titanium dioxide results in increased expression of SLC34A2 mRNA CTD PMID:23557971 Slc34a2 Rat titanium dioxide decreases methylation ISO Slc34a2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SLC34A2 promoter CTD PMID:35295148 Slc34a2 Rat titanium dioxide multiple interactions ISO Slc34a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC34A2 mRNA CTD PMID:29950665 Slc34a2 Rat tributylstannane decreases expression ISO Slc34a2 (Mus musculus) 6480464 tributyltin results in decreased expression of SLC34A2 mRNA CTD PMID:31939706 Slc34a2 Rat trichloroethene decreases expression ISO Slc34a2 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of SLC34A2 mRNA CTD PMID:28973375 Slc34a2 Rat triclosan increases expression ISO SLC34A2 (Homo sapiens) 6480464 Triclosan results in increased expression of SLC34A2 mRNA CTD PMID:30510588 Slc34a2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of SLC34A2 mRNA CTD PMID:30589522 Slc34a2 Rat triptonide increases expression ISO Slc34a2 (Mus musculus) 6480464 triptonide results in increased expression of SLC34A2 mRNA CTD PMID:33045310 Slc34a2 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of SLC34A2 mRNA CTD PMID:21515302 Slc34a2 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat tungstate multiple interactions EXP 6480464 tungstate promotes the reaction [Fructose results in decreased expression of SLC34A2 mRNA] CTD PMID:18400728 Slc34a2 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of SLC34A2 mRNA CTD PMID:24136188 Slc34a2 Rat valproic acid decreases methylation ISO SLC34A2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SLC34A2 gene CTD PMID:29154799 Slc34a2 Rat valproic acid increases expression ISO SLC34A2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC34A2 mRNA CTD PMID:26272509 Slc34a2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SLC34A2 mRNA CTD PMID:19015723 Slc34a2 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of SLC34A2 mRNA CTD PMID:27225895 Slc34a2 Rat zaragozic acid A decreases expression ISO Slc34a2 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of SLC34A2 mRNA CTD PMID:27225895 Slc34a2 Rat zoledronic acid increases expression ISO SLC34A2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SLC34A2 mRNA CTD PMID:24714768
1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bromobenzene (EXP) buspirone (EXP) calcitriol (ISO) chlorohydrocarbon (EXP) clofibrate (EXP) cyclosporin A (EXP) dextran sulfate (ISO) dieldrin (EXP) diethyl phthalate (EXP) dimethylarsinic acid (ISO) dioxygen (ISO) endosulfan (EXP) ethylparaben (ISO) fenofibrate (EXP) fentin chloride (EXP) flutamide (EXP) fonofos (ISO) formaldehyde (ISO) fructose (EXP) fulvestrant (ISO) furan (EXP) heptachlor (EXP) indole-3-methanol (EXP) iron atom (EXP) iron(0) (EXP) leflunomide (EXP) methotrexate (ISO) methylarsonic acid (ISO) methylmercury chloride (EXP) mirex (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-nitrosodiethylamine (EXP) nefazodone (EXP) nevirapine (EXP) nickel atom (ISO) nickel sulfate (ISO) nimesulide (EXP) nitrofen (EXP) oxycodone (EXP) paracetamol (EXP) paraquat (EXP) parathion (ISO) perfluorooctanoic acid (EXP) phenformin (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) pravastatin (EXP,ISO) propiconazole (ISO) prothioconazole (ISO) rotenone (EXP) sodium arsenate (ISO) sodium arsenite (ISO) tacrolimus hydrate (EXP) tamoxifen (ISO) terbufos (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (ISO) triclosan (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (EXP) trovafloxacin (EXP) tungstate (EXP) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) zaragozic acid A (EXP,ISO) zoledronic acid (ISO)
1.
Identification and localization of sodium-phosphate cotransporters in hepatocytes and cholangiocytes of rat liver.
Frei P, etal., Am J Physiol Gastrointest Liver Physiol. 2005 Apr;288(4):G771-8. Epub 2004 Nov 24.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
NHE3 regulatory factor 1 (NHERF1) modulates intestinal sodium-dependent phosphate transporter (NaPi-2b) expression in apical microvilli.
Giral H, etal., J Biol Chem. 2012 Oct 12;287(42):35047-56. doi: 10.1074/jbc.M112.392415. Epub 2012 Aug 17.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Isolation and localization of type IIb Na/Pi cotransporter in the developing rat lung.
Hashimoto M, etal., Am J Pathol 2000 Jul;157(1):21-7.
6.
Luminal fructose inhibits rat intestinal sodium-phosphate cotransporter gene expression and phosphate uptake.
Kirchner S, etal., Am J Clin Nutr. 2008 Apr;87(4):1028-38.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Phosphate handling: new genes, new molecules.
Prie D, etal., Horm Res Paediatr. 2011;76 Suppl 1:71-5. doi: 10.1159/000329175. Epub 2011 Jul 21.
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.
Role of rat sodium/phosphate cotransporters in the cell membrane transport of arsenate.
Villa-Bellosta R and Sorribas V, Toxicol Appl Pharmacol. 2008 Oct 1;232(1):125-34. Epub 2008 Jun 10.
16.
Regulation of intestinal NaPi-IIb cotransporter gene expression by estrogen.
Xu H, etal., Am J Physiol Gastrointest Liver Physiol. 2003 Dec;285(6):G1317-24. Epub 2003 Jul 31.
Slc34a2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 62,123,313 - 62,153,020 (-) NCBI GRCr8 mRatBN7.2 14 57,910,931 - 57,930,236 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 57,910,480 - 57,930,436 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 62,312,729 - 62,331,995 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 63,631,450 - 63,650,714 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 60,028,211 - 60,047,475 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 60,257,211 - 60,276,516 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 60,256,712 - 60,276,794 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 60,375,980 - 60,395,841 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 62,660,006 - 62,679,311 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 62,661,945 - 62,674,066 (-) NCBI Celera 14 57,011,613 - 57,030,915 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
SLC34A2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 25,655,851 - 25,678,748 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 25,648,011 - 25,678,748 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 25,657,473 - 25,680,370 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 25,266,533 - 25,289,468 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 25,333,741 - 25,354,773 NCBI Celera 4 26,105,505 - 26,128,442 (+) NCBI Celera Cytogenetic Map 4 p15.2 NCBI HuRef 4 24,995,885 - 25,018,820 (+) NCBI HuRef CHM1_1 4 25,657,246 - 25,680,195 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 25,637,821 - 25,660,720 (+) NCBI T2T-CHM13v2.0
Slc34a2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 53,206,695 - 53,229,006 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 53,195,423 - 53,229,006 (+) Ensembl GRCm39 Ensembl GRCm38 5 53,049,353 - 53,071,664 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 53,038,081 - 53,071,664 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 53,440,592 - 53,462,903 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 53,337,630 - 53,359,912 (+) NCBI MGSCv36 mm8 Celera 5 50,429,966 - 50,452,261 (+) NCBI Celera Cytogenetic Map 5 C1 NCBI cM Map 5 28.92 NCBI
Slc34a2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955443 19,452,306 - 19,467,129 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955443 19,452,373 - 19,467,129 (-) NCBI ChiLan1.0 ChiLan1.0
SLC34A2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 25,904,193 - 25,927,027 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 26,099,982 - 26,122,819 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 20,056,254 - 20,079,012 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 25,336,538 - 25,359,381 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 25,336,538 - 25,359,381 (+) Ensembl panpan1.1 panPan2
SLC34A2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 84,686,505 - 84,717,579 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 84,686,425 - 84,742,038 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 87,197,404 - 87,228,556 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 85,655,124 - 85,686,281 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 85,655,645 - 85,714,088 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 84,777,180 - 84,808,314 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 84,897,108 - 84,928,226 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 85,280,888 - 85,312,032 (-) NCBI UU_Cfam_GSD_1.0
Slc34a2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 50,252,670 - 50,273,639 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936477 3,956,061 - 3,966,392 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936477 3,954,377 - 3,975,259 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC34A2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 19,481,198 - 19,509,666 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 19,481,127 - 19,507,903 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 19,819,341 - 19,847,993 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC34A2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 24,674,419 - 24,698,844 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 24,674,584 - 24,690,984 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 71,188,809 - 71,212,116 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc34a2
.
Predicted Target Of
Count of predictions: 181 Count of miRNA genes: 138 Interacting mature miRNAs: 158 Transcripts: ENSRNOT00000048509 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 70214 Niddm28 Non-insulin dependent diabetes mellitus QTL 28 4.06 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 39998251 75582726 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
RH127919
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 57,910,622 - 57,910,810 (+) MAPPER mRatBN7.2 Rnor_6.0 14 60,256,903 - 60,257,090 NCBI Rnor6.0 Rnor_5.0 14 60,376,126 - 60,376,313 UniSTS Rnor5.0 RGSC_v3.4 14 62,659,698 - 62,659,885 UniSTS RGSC3.4 Celera 14 57,011,305 - 57,011,492 UniSTS Cytogenetic Map 14 q11 UniSTS
RH133883
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 57,911,020 - 57,911,235 (+) MAPPER mRatBN7.2 Rnor_6.0 14 60,257,301 - 60,257,515 NCBI Rnor6.0 Rnor_5.0 14 60,376,524 - 60,376,738 UniSTS Rnor5.0 RGSC_v3.4 14 62,660,096 - 62,660,310 UniSTS RGSC3.4 Celera 14 57,011,703 - 57,011,917 UniSTS Cytogenetic Map 14 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
20
57
86
90
59
25
59
6
175
58
41
41
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048509 ⟹ ENSRNOP00000050889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,910,931 - 57,930,436 (-) Ensembl Rnor_6.0 Ensembl 14 60,256,712 - 60,276,794 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111481 ⟹ ENSRNOP00000083766
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,910,480 - 57,930,244 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117888 ⟹ ENSRNOP00000096758
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,910,931 - 57,930,436 (-) Ensembl
RefSeq Acc Id:
NM_053380 ⟹ NP_445832
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 62,123,767 - 62,143,072 (-) NCBI mRatBN7.2 14 57,910,931 - 57,930,236 (-) NCBI Rnor_6.0 14 60,257,211 - 60,276,516 (-) NCBI Rnor_5.0 14 60,375,980 - 60,395,841 (-) NCBI RGSC_v3.4 14 62,660,006 - 62,679,311 (-) RGD Celera 14 57,011,613 - 57,030,915 (-) RGD
Sequence:
CTGTCCCTTACCTGCGAAGGGAGCGCTGACCATGGCTCCTTGGCCCGAGTTGGAAAATGCCCACCCCAACCCCAATAAATTCATCGAAGGGGCCTCAGGTCCACAGTCTAGCATACCAGACAAAGACA
hide sequence
RefSeq Acc Id:
XM_063273681 ⟹ XP_063129751
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 62,123,313 - 62,153,020 (-) NCBI
RefSeq Acc Id:
NP_445832 ⟸ NM_053380
- UniProtKB:
Q8VI55 (UniProtKB/Swiss-Prot), Q9JJ09 (UniProtKB/Swiss-Prot), A6IJG4 (UniProtKB/TrEMBL), A0A8I5ZXN1 (UniProtKB/TrEMBL)
- Sequence:
MAPWPELENAHPNPNKFIEGASGPQSSIPDKDKGTSKTNDSGTPVAKIELLPSYSALVLIEEPPEGNDPWDLPELQDNGIKWSERDSKGKILCIFQGIGKFILLLGFLYLFVCSLDVLSSAFQLVGGK
hide sequence
Ensembl Acc Id:
ENSRNOP00000050889 ⟸ ENSRNOT00000048509
Ensembl Acc Id:
ENSRNOP00000083766 ⟸ ENSRNOT00000111481
Ensembl Acc Id:
ENSRNOP00000096758 ⟸ ENSRNOT00000117888
RefSeq Acc Id:
XP_063129751 ⟸ XM_063273681
- Peptide Label:
isoform X1
- UniProtKB:
Q9JJ09 (UniProtKB/Swiss-Prot), Q8VI55 (UniProtKB/Swiss-Prot), A6IJG4 (UniProtKB/TrEMBL), A0A8I5ZXN1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc34a2
solute carrier family 34 member 2
Slc34a2
solute carrier family 34 (type II sodium/phosphate cotransporter), member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-11-26
Slc34a2
solute carrier family 34 (type II sodium/phosphate cotransporter), member 2
Slc34a2
solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Name changed
629549 APPROVED
2013-08-02
Slc34a2
solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Slc34a2
solute carrier family 34 (sodium phosphate), member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Slc34a2
solute carrier family 34 (sodium phosphate), member 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Slc34a2
solute carrier family 34 (sodium phosphate), member 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in type II alveolar cells of the developing lung
634065
