Advanced Search (OLGA)

Gene: Ccnl1 (cyclin L1) Rattus norvegicus

Analyze

Symbol:

Ccnl1

Name:

cyclin L1

RGD ID:

620864

Description:

Predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity. Predicted to be involved in regulation of RNA splicing. Located in nuclear speck. Orthologous to human CCNL1 (cyclin L1); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ania-6a; Ccnl; cyclin Ania-6a; cyclin L; cyclin-L; cyclin-L1; cyclin-L1-like; LOC100909712; MGC93069

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCNL1 (cyclin L1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccnl1 (cyclin L1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Ccnl1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCNL1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCNL1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccnl1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCNL1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCNL1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccnl1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccnl1 (cyclin L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CCNL1 (cyclin L1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccnl1 (cyclin L1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccnl1a (cyclin L1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccnl1b (cyclin L1b)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG16903	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16903	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyl-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyl-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccnl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccnl1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	152,495,169 - 152,508,855 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	152,495,172 - 152,507,468 (-)	Ensembl				GRCr8
mRatBN7.2	2	150,184,865 - 150,199,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	150,184,798 - 150,197,368 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	157,294,697 - 157,307,010 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	155,345,203 - 155,357,516 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	149,977,917 - 149,990,230 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	157,747,295 - 157,759,838 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	157,747,542 - 157,759,838 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	177,110,678 - 177,122,977 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	155,757,335 - 155,769,633 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	144,599,445 - 144,611,743 (-)	NCBI		Celera
RGSC_v3.1	2	155,707,300 - 155,719,596 (-)	NCBI
Cytogenetic Map	2	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetaldehyde (ISO)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

capsaicin (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

chrysene (ISO)

clozapine (EXP)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dimethyl sulfoxide (ISO)

doxorubicin (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

glucose (ISO)

glyphosate (EXP)

haloperidol (EXP)

imidacloprid (EXP)

leflunomide (ISO)

lipopolysaccharide (EXP)

methamphetamine (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mono(2-ethyl-5-oxohexyl) phthalate (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nefazodone (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (EXP)

rac-lactic acid (ISO)

ranitidine (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thiabendazole (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of mRNA splicing, via spliceosome (IEA,ISO)

regulation of RNA splicing (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA)

Cellular Component

cyclin L-CDK11 complex (IEA,ISO)

cyclin-dependent protein kinase holoenzyme complex (IEA,ISO)

nuclear body (IEA,ISO)

nuclear speck (IDA,IEA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

cyclin-dependent protein serine/threonine kinase regulator activity (IBA,IEA,ISO)

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A complex program of striatal gene expression induced by dopaminergic stimulation.	Berke JD, etal., J Neurosci 1998 Jul 15;18(14):5301-10.
2.	Dopamine and glutamate induce distinct striatal splice forms of Ania-6, an RNA polymerase II-associated cyclin.	Berke JD, etal., Neuron 2001 Oct 25;32(2):277-87.
3.	Identification and characterization of the CDK12/cyclin L1 complex involved in alternative splicing regulation.	Chen HH, etal., Mol Cell Biol. 2006 Apr;26(7):2736-45.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Regulation of ania-6 splice variants by distinct signaling pathways in striatal neurons.	Sgambato V, etal., J Neurochem 2003 Jul;86(1):153-64.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:17494991

Genomics

Comparative Map Data

Ccnl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	152,495,169 - 152,508,855 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	152,495,172 - 152,507,468 (-)	Ensembl				GRCr8
mRatBN7.2	2	150,184,865 - 150,199,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	150,184,798 - 150,197,368 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	157,294,697 - 157,307,010 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	155,345,203 - 155,357,516 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	149,977,917 - 149,990,230 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	157,747,295 - 157,759,838 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	157,747,542 - 157,759,838 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	177,110,678 - 177,122,977 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	155,757,335 - 155,769,633 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	144,599,445 - 144,611,743 (-)	NCBI		Celera
RGSC_v3.1	2	155,707,300 - 155,719,596 (-)	NCBI
Cytogenetic Map	2	q31	NCBI

CCNL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	157,143,121 - 157,160,147 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	157,146,508 - 157,160,760 (-)	Ensembl			hg38	GRCh38
GRCh37	3	156,860,910 - 156,877,936 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	158,348,279 - 158,361,176 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	158,348,286 - 158,361,184	NCBI
Celera	3	155,289,188 - 155,302,097 (-)	NCBI		Celera
Cytogenetic Map	3	q25.31	NCBI
HuRef	3	154,261,958 - 154,274,873 (-)	NCBI		HuRef
CHM1_1	3	156,828,587 - 156,841,484 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	159,917,663 - 159,934,689 (-)	NCBI		T2T-CHM13v2.0

Ccnl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	65,853,333 - 65,869,451 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	65,853,572 - 65,865,670 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	65,945,908 - 65,962,029 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	65,946,151 - 65,958,249 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	65,750,073 - 65,762,147 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	66,034,080 - 66,046,148 (-)	NCBI		MGSCv36	mm8
Celera	3	66,084,322 - 66,096,395 (-)	NCBI		Celera
Cytogenetic Map	3	E1	NCBI
cM Map	3	30.25	NCBI

Ccnl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	8,113,216 - 8,124,628 (-)	Ensembl
ChiLan1.0	NW_004955448	8,112,774 - 8,125,912 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCNL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	155,055,162 - 155,075,647 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	155,062,940 - 155,080,377 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	154,192,971 - 154,210,468 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	162,250,825 - 162,264,645 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	162,251,326 - 162,263,174 (-)	Ensembl			panPan2	panpan1.1

CCNL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	50,639,851 - 50,643,777 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	50,512,891 - 50,525,567 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	51,273,830 - 51,286,528 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	51,273,791 - 51,287,522 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	50,857,079 - 50,869,721 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	50,909,267 - 50,921,953 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	51,194,168 - 51,206,919 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccnl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	85,676,959 - 85,689,190 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	4,044,708 - 4,056,993 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	4,044,762 - 4,056,987 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCNL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	96,986,266 - 97,002,467 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	96,984,542 - 97,004,401 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	105,143,782 - 105,161,937 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCNL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	33,592,391 - 33,608,124 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	33,593,500 - 33,609,195 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	6,181,869 - 6,195,601 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccnl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	34,754,581 - 34,768,879 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	34,712,248 - 34,768,236 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccnl1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	89,759,377 - 89,772,405 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccnl1
90 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	233
Count of miRNA genes:	159
Interacting mature miRNAs:	186
Transcripts:	ENSRNOT00000016016
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	124103798	154505346	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	145807215	190807215	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	150313808	195313808	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	143565208	188565208	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	139067258	192287892	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	120039407	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	139067258	184067258	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150096616	195096616	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	147287892	192287892	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	120339555	165339555	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149806826	170653323	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150096616	195096616	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	145807215	173074435	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat

Markers in Region

T03514

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	150,185,151 - 150,185,341 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	157,747,582 - 157,747,771	NCBI	Rnor6.0
Rnor_5.0	2	177,110,721 - 177,110,910	UniSTS	Rnor5.0
RGSC_v3.4	2	155,757,378 - 155,757,567	UniSTS	RGSC3.4
Celera	2	144,599,488 - 144,599,677	UniSTS
Cytogenetic Map	2	q31	UniSTS

RH130191

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	150,184,898 - 150,185,092 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	157,747,329 - 157,747,522	NCBI	Rnor6.0
Rnor_5.0	2	177,110,468 - 177,110,661	UniSTS	Rnor5.0
RGSC_v3.4	2	155,757,125 - 155,757,318	UniSTS	RGSC3.4
Celera	2	144,599,235 - 144,599,428	UniSTS
RH 3.4 Map	2	974.8	UniSTS
Cytogenetic Map	2	q31	UniSTS

RH143534

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	150,190,597 - 150,190,789 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	157,753,028 - 157,753,219	NCBI	Rnor6.0
Rnor_5.0	2	177,116,167 - 177,116,358	UniSTS	Rnor5.0
RGSC_v3.4	2	155,762,824 - 155,763,015	UniSTS	RGSC3.4
Celera	2	144,604,933 - 144,605,124	UniSTS
RH 3.4 Map	2	970.7	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	12	61	134	57	60	41	86	41	298	168	11	125	71	73	19	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF030091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085686	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC128699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB608234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015763 ⟹ ENSRNOP00000015763

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	152,495,172 - 152,507,468 (-)	Ensembl
mRatBN7.2 Ensembl	2	150,185,109 - 150,197,348 (-)	Ensembl
Rnor_6.0 Ensembl	2	157,747,542 - 157,759,819 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000016016 ⟹ ENSRNOP00000016016

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	152,504,356 - 152,507,415 (-)	Ensembl
mRatBN7.2 Ensembl	2	150,184,798 - 150,197,368 (-)	Ensembl
Rnor_6.0 Ensembl	2	157,747,542 - 157,759,838 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109005 ⟹ ENSRNOP00000085346

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	152,495,172 - 152,507,468 (-)	Ensembl
mRatBN7.2 Ensembl	2	150,184,798 - 150,197,368 (-)	Ensembl

RefSeq Acc Id:

NM_053662 ⟹ NP_446114

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,495,169 - 152,507,468 (-)	NCBI
mRatBN7.2	2	150,185,109 - 150,197,408 (-)	NCBI
Rnor_6.0	2	157,747,539 - 157,759,838 (-)	NCBI
Rnor_5.0	2	177,110,678 - 177,122,977 (-)	NCBI
RGSC_v3.4	2	155,757,335 - 155,769,633 (-)	RGD
Celera	2	144,599,445 - 144,611,743 (-)	RGD

Sequence:

show sequence

GTCACGGGAATATCCGTCGCGCCGAGGACGCTGGTTAGTCTCGCTTTGGGTTCCGGCTGCGTCG
GGCGTGCGTGTAGCTCGCTAGAACTATGGCGTCCGGGCCTCACCCGACATCGACCGCTGCCGCC
GCCTCTGCCTCGTCCGCCGCCCCGAGTGCGGGCGGCTCCAGCTCCGGCACGACGACCACGACGA
CGACGACGACCGGAGGGATCCTGATTGGCGACCGCCTGTACTCGGAGGTGTCGCTTACCATCGA
CCACTCGGTGATTCCGGAGGAGCGGCTCTCGCCTACCCCGTCCATGCAGGACGGCCTCGACCTG
CCCAGCGAGACGGACCTGCGCATCTTAGGCTGCGAGCTCATCCAGGCCGCCGGCATTCTCCTCC
GGCTGCCGCAGGTGGCGATGGCTACGGGGCAGGTGTTGTTTCATCGTTTTTTCTACTCCAAGTC
TTTCGTCAAACACAGTTTCGAGATTGTTGCCATGGCCTGTATTAATCTTGCATCAAAAATTGAA
GAAGCACCAAGAAGAATAAGAGATGTGATTAATGTATTCCACCACCTCCGCCAGTTAAGAGGAA
AAAGGACTCCAAGCCCCCTGATCCTTGATCAGAACTACATTAACACCAAAAATCAAGTTATCAA
GGCAGAGAGGAGGGTGCTAAAGGAGTTGGGATTTTGTGTTCATGTCAAGCATCCCCATAAGATC
ATTGTAATGTATTTACAAGTCTTAGAATGTGAACGTAACCAAACCCTGGTTCAGACTGCCTGGA
ATTATATGAATGACAGTCTTCGAACCAATGTTTTTGTTCGCTTTCAACCAGAGACTATAGCATG
TGCTTGTATCTACCTTGCAGCTAGAGCACTTCAAATTCCATTGCCAACTCGGCCCCATTGGTTT
CTTCTTTTTGGTACCACAGAAGAGGAGATTCAAGAAATCTGCATAGAGACACTTAGACTTTATA
CCAGGAAAAAGCCTAACTATGAATTGCTGGAAAAGGAAGTAGAAAAAAGAAAAGTAGCCTTACA
GGAAGCCAAGTTAAAGGCAAAGGGATTGAATCTTGATGGAACTCCAGCCCTTTCCACTTTAGGT
GGTTTTTCTCCAGCCTCCAAACCATCATCACCAAGAGAAGTAAAAGCTGAAGAGAAATCACCAG
TTTCCATTAATGTGAAGACAGTCAAAAAAGAACCTGAGGATAGACAACAAGCTTCCAAAAGCCC
TTATAATGGTGTAAGAAAAGACAGCAAGAGAAGCAGAAACAGCAGAAGTGCCAGTAGATCAAGG
TCAAGAACCAGGTCACGCTCTAGATCACACACCCCAAGAAGACATTATAATAATAGGCGAAGTC
GATCTGGAACATACAGCTCAAGATCAAGAAGCAGGTCTCGCAGTCACAGTGAAAGTCCTCGAAG
ACATCATAATCATGGTTCTCCTCACCTTAAGGCCAAACATACCAGAGAAGATTTAAAAAGCTCA
AATAGACATGGTCATAAAAGGAAAAAATCTCGGTCTCGATCTCAGAGCAAGACTCGGGATCACT
CAGATGTTACCAAGAAACACAGGCATGAAAGGGGGCATCACAGAGACAGGCGTGAAAGATCTCG
CTCCTTTGAGAGGTCCCATAAAGGCAAGCACCACGGTGGAAGTCGCTCAGGACATGGCAGGCAT
AGGCGCTGACTTTCATCCTCTGACACTGCATCGGTCCCTGGTGTTGCCCATATGCAGTGTGACG
ATGTATGGACTCAATCAAAACATGAAAAGCAAACTGATTAGGGATTGATTTATTAAAATTGTCT
AGGTTTCTAGAAACACTGAGGACATTTTCTTTTGAAAAGAACTATGTTAAGGTTTTTTGCACAT
TAAAATGCCCTAGCAGTATCTAATTGAAAACCATGGTCAGGTTCAATTGTACTTTATTATAGTT
GTGTATTGTTTATTGCTATAAGAACTGGAGCGTAAATTCTGTAAAAATGTATCTTATTTTTATA
CAGATAAAACTTGCAGACACTGTTCTATTTAAGTGGTTATTTGTTTAAATGATGGTGAATACTT
TCTTAACACTGGTTTGTCCGCATGTGTAAAGATTTTTACAAGGAAATAAAATACAAATCTTGTT
TTTCTAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063281136 ⟹ XP_063137206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,495,169 - 152,506,168 (-)	NCBI

RefSeq Acc Id:

XM_063281137 ⟹ XP_063137207

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,495,169 - 152,506,201 (-)	NCBI

RefSeq Acc Id:

XM_063281138 ⟹ XP_063137208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,498,342 - 152,508,855 (-)	NCBI

RefSeq Acc Id:

XM_063281139 ⟹ XP_063137209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,500,549 - 152,508,825 (-)	NCBI

RefSeq Acc Id:

XM_063281140 ⟹ XP_063137210

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,500,549 - 152,508,829 (-)	NCBI

RefSeq Acc Id:

XR_010063577

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	152,500,549 - 152,508,824 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446114	(Get FASTA)	NCBI Sequence Viewer
	XP_063137206	(Get FASTA)	NCBI Sequence Viewer
	XP_063137207	(Get FASTA)	NCBI Sequence Viewer
	XP_063137208	(Get FASTA)	NCBI Sequence Viewer
	XP_063137209	(Get FASTA)	NCBI Sequence Viewer
	XP_063137210	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD45558	(Get FASTA)	NCBI Sequence Viewer
	AAH85686	(Get FASTA)	NCBI Sequence Viewer
	AAI61817	(Get FASTA)	NCBI Sequence Viewer
	EDM00936	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015763
	ENSRNOP00000016016
	ENSRNOP00000016016.2
GenBank Protein	Q9R1Q2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446114 ⟸ NM_053662

- UniProtKB:

Q5U364 (UniProtKB/Swiss-Prot), Q9R1Q2 (UniProtKB/Swiss-Prot), B1WBN1 (UniProtKB/TrEMBL), A0A8I6A3Q0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASGPHPTSTAAAASASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSVIPEER
LSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEI
VAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKE
LGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAAR
ALQIPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKG
LNLDGTPALSTLGGFSPASKPSSPREVKAEEKSPVSINVKTVKKEPEDRQQASKSPYNGVRKDS
KRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSGTYSSRSRSRSRSHSESPRRHHNHGSPH
LKAKHTREDLKSSNRHGHKRKKSRSRSQSKTRDHSDVTKKHRHERGHHRDRRERSRSFERSHKG
KHHGGSRSGHGRHRR

hide sequence

Ensembl Acc Id:

ENSRNOP00000015763 ⟸ ENSRNOT00000015763

Ensembl Acc Id:

ENSRNOP00000016016 ⟸ ENSRNOT00000016016

Ensembl Acc Id:

ENSRNOP00000085346 ⟸ ENSRNOT00000109005

RefSeq Acc Id:	XP_063137207 ⟸ XM_063281137
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063137206 ⟸ XM_063281136
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063137208 ⟸ XM_063281138
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063137210 ⟸ XM_063281140
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063137209 ⟸ XM_063281139
- Peptide Label:	isoform X4

Protein Domains

Cyclin C-terminal Cyclin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R1Q2-F1-model_v2	AlphaFold	Q9R1Q2	1-527	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620864	AgrOrtholog
BioCyc Gene	G2FUF-52881	BioCyc
Ensembl Genes	ENSRNOG00000011586	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015763	ENTREZGENE
	ENSRNOT00000016016	ENTREZGENE
	ENSRNOT00000016016.6	UniProtKB/Swiss-Prot
Gene3D-CATH	Cyclin-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:9022416	IMAGE-MGC_LOAD
InterPro	Cyclin-like	UniProtKB/Swiss-Prot
	Cyclin-like_sf	UniProtKB/Swiss-Prot
	Cyclin/Ssn8	UniProtKB/Swiss-Prot
	Cyclin_C-dom	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
KEGG Report	rno:114121	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187267	IMAGE-MGC_LOAD
NCBI Gene	114121	ENTREZGENE
PANTHER	PTHR10026	UniProtKB/Swiss-Prot
Pfam	Cyclin_C	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
PhenoGen	Ccnl1	PhenoGen
PIRSF	Cyclin_L	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011586	RatGTEx
SMART	CYCLIN	UniProtKB/Swiss-Prot
	Cyclin_C	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47954	UniProtKB/Swiss-Prot
UniProt	A0A8I6A3Q0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q7J2_RAT	UniProtKB/TrEMBL
	B1WBN1	ENTREZGENE, UniProtKB/TrEMBL
	CCNL1_RAT	UniProtKB/Swiss-Prot
	Q5U364	ENTREZGENE
	Q9R1Q2	ENTREZGENE
UniProt Secondary	Q5U364	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Ccnl1	cyclin L1	LOC100909712	cyclin-L1-like	Data merged from RGD:6501887	737654	PROVISIONAL
2012-07-05	LOC100909712	cyclin-L1-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Ccnl1	cyclin L1	Ccnl	cyclin L	Symbol and Name updated	1299863	APPROVED
2002-08-07	Ccnl	cyclin L			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to nuclear speckles	632453
gene_pathway	may be induced by dopamine-activated signalling pathway	631964

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message