Symbol:
Rpl36 (Ensembl: Rpl36l7)
Name:
ribosomal protein L36 (Ensembl:ribosomal protein L36 like 7)
RGD ID:
62085
Description:
Predicted to be a structural constituent of ribosome. Predicted to be involved in cytoplasmic translation. Part of cytosolic large ribosomal subunit. Orthologous to human RPL36 (ribosomal protein L36); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
60S ribosomal protein L36; large ribosomal subunit protein eL36
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPL36 (ribosomal protein L36) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Rpl36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rpl36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPL36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RPL36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rpl36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPL36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPL36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rpl36 (ribosomal protein L36) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Rpl36 (ribosomal protein L36)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Homo sapiens (human):
RPL36 (ribosomal protein L36)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
rpl36 (ribosomal protein L36)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpl-36
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPL36A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPL36B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpL36
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rpl36
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,529,117 - 1,534,534 (+) NCBI GRCr8 mRatBN7.2 9 1,441,986 - 1,447,397 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 98,809,534 - 98,809,897 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 5 148,321,225 - 148,321,524 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 1,880,070 - 1,880,823 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,230,252 - 7,231,005 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,185,275 - 6,186,028 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,441,228 - 10,441,981 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,441,259 - 10,441,834 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,438,155 - 9,438,908 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 7,066,440 - 7,067,193 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rpl36 Rat (-)-epigallocatechin 3-gallate increases expression ISO RPL36 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of RPL36 protein CTD PMID:31195006 Rpl36 Rat (1->4)-beta-D-glucan multiple interactions ISO Rpl36 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL36 mRNA CTD PMID:36331819 Rpl36 Rat 1,4-benzoquinone multiple interactions ISO RPL36 (Homo sapiens) 6480464 IGF2BP1 inhibits the reaction [quinone results in decreased expression of RPL36 mRNA] more ... CTD PMID:38367942 Rpl36 Rat 1,4-benzoquinone decreases expression ISO RPL36 (Homo sapiens) 6480464 quinone results in decreased expression of RPL36 mRNA CTD PMID:38367942 Rpl36 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RPL36 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to RPL36 protein CTD PMID:32991956 Rpl36 Rat 17beta-estradiol decreases expression ISO RPL36 (Homo sapiens) 6480464 Estradiol results in decreased expression of RPL36 mRNA CTD PMID:23019147 Rpl36 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rpl36 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rpl36 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPL36 mRNA CTD PMID:34747641 Rpl36 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPL36 mRNA CTD PMID:33387578 Rpl36 Rat 2,6-dimethoxyphenol multiple interactions ISO RPL36 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Rpl36 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of RPL36 mRNA CTD PMID:28522335 Rpl36 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of RPL36 mRNA CTD PMID:19162173 Rpl36 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Rpl36 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of RPL36 mRNA CTD PMID:18648102 Rpl36 Rat 4,4'-sulfonyldiphenol increases expression ISO Rpl36 (Mus musculus) 6480464 bisphenol S results in increased expression of RPL36 mRNA CTD PMID:39298647 Rpl36 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of RPL36 protein CTD PMID:33236894 Rpl36 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPL36 mRNA CTD PMID:16483693 Rpl36 Rat antimycin A increases expression ISO RPL36 (Homo sapiens) 6480464 Antimycin A results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat aristolochic acid A decreases expression ISO RPL36 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RPL36 protein CTD PMID:33212167 Rpl36 Rat arsane affects methylation ISO RPL36 (Homo sapiens) 6480464 Arsenic affects the methylation of RPL36 gene CTD PMID:25304211 Rpl36 Rat arsenic atom affects methylation ISO RPL36 (Homo sapiens) 6480464 Arsenic affects the methylation of RPL36 gene CTD PMID:25304211 Rpl36 Rat arsenite(3-) multiple interactions ISO RPL36 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPL36 mRNA] CTD PMID:32406909 Rpl36 Rat azoxystrobin increases expression ISO RPL36 (Homo sapiens) 6480464 azoxystrobin results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat benzene multiple interactions ISO Rpl36 (Mus musculus) 6480464 IGF2BP1 inhibits the reaction [Benzene results in decreased expression of RPL36 mRNA] CTD PMID:38367942 Rpl36 Rat benzene decreases expression ISO Rpl36 (Mus musculus) 6480464 Benzene results in decreased expression of RPL36 mRNA CTD PMID:38367942 Rpl36 Rat benzo[a]pyrene multiple interactions ISO Rpl36 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to RPL36 promoter] CTD PMID:19654925 Rpl36 Rat benzo[a]pyrene increases methylation ISO RPL36 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RPL36 promoter CTD PMID:27901495 Rpl36 Rat benzo[a]pyrene decreases expression ISO Rpl36 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RPL36 mRNA CTD PMID:20504355 and PMID:27195522 Rpl36 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of RPL36 promoter CTD PMID:23359474 Rpl36 Rat bis(2-ethylhexyl) phthalate increases expression ISO Rpl36 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RPL36 mRNA CTD PMID:33754040 Rpl36 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of RPL36 promoter CTD PMID:23359474 Rpl36 Rat bisphenol A increases expression ISO RPL36 (Homo sapiens) 6480464 bisphenol A results in increased expression of RPL36 protein CTD PMID:34186270 Rpl36 Rat bisphenol A decreases expression ISO Rpl36 (Mus musculus) 6480464 bisphenol A results in decreased expression of RPL36 mRNA CTD PMID:35598803 Rpl36 Rat bisphenol A multiple interactions ISO RPL36 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RPL36 gene CTD PMID:31601247 Rpl36 Rat bisphenol A decreases expression ISO RPL36 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPL36 mRNA and bisphenol A results in decreased expression of RPL36 protein CTD PMID:37567409 and PMID:38568856 Rpl36 Rat bisphenol A increases expression ISO Rpl36 (Mus musculus) 6480464 bisphenol A results in increased expression of RPL36 mRNA CTD PMID:38074096 Rpl36 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RPL36 mRNA CTD PMID:32145629 Rpl36 Rat bisphenol A affects expression ISO RPL36 (Homo sapiens) 6480464 bisphenol A affects the expression of RPL36 mRNA CTD PMID:30903817 Rpl36 Rat Bisphenol B increases expression ISO RPL36 (Homo sapiens) 6480464 bisphenol B results in increased expression of RPL36 protein CTD PMID:34186270 Rpl36 Rat bisphenol F decreases expression ISO Rpl36 (Mus musculus) 6480464 bisphenol F results in decreased expression of RPL36 mRNA CTD PMID:38685157 Rpl36 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of RPL36 mRNA CTD PMID:19167457 Rpl36 Rat cadmium atom multiple interactions ISO Rpl36 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RPL36 mRNA CTD PMID:36114956 Rpl36 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of RPL36 promoter CTD PMID:22457795 Rpl36 Rat cadmium dichloride multiple interactions ISO Rpl36 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RPL36 mRNA CTD PMID:36114956 Rpl36 Rat cadmium dichloride increases expression ISO RPL36 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RPL36 mRNA CTD PMID:38568856 Rpl36 Rat caffeine increases expression ISO RPL36 (Homo sapiens) 6480464 Caffeine results in increased expression of RPL36 protein CTD PMID:31195006 Rpl36 Rat chloropicrin decreases expression ISO RPL36 (Homo sapiens) 6480464 chloropicrin results in decreased expression of RPL36 mRNA CTD PMID:26352163 Rpl36 Rat chromium(6+) affects expression ISO Rpl36 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of RPL36 mRNA CTD PMID:28472532 Rpl36 Rat cisplatin decreases response to substance ISO RPL36 (Homo sapiens) 6480464 RPL36 protein results in decreased susceptibility to Cisplatin CTD PMID:16394183 Rpl36 Rat clofibrate multiple interactions ISO Rpl36 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RPL36 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RPL36 mRNA] CTD PMID:17585979 Rpl36 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of RPL36 mRNA CTD PMID:20187946 Rpl36 Rat cyclosporin A increases expression ISO RPL36 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RPL36 mRNA CTD PMID:20106945 Rpl36 Rat deguelin increases expression ISO RPL36 (Homo sapiens) 6480464 deguelin results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of RPL36 promoter CTD PMID:23359474 Rpl36 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RPL36 mRNA CTD PMID:29391264 Rpl36 Rat enzyme inhibitor multiple interactions ISO RPL36 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPL36 protein CTD PMID:23301498 Rpl36 Rat epoxiconazole decreases expression ISO Rpl36 (Mus musculus) 6480464 epoxiconazole results in decreased expression of RPL36 mRNA CTD PMID:35436446 Rpl36 Rat fenpyroximate increases expression ISO RPL36 (Homo sapiens) 6480464 fenpyroximate results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat fulvestrant multiple interactions ISO RPL36 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RPL36 gene CTD PMID:31601247 Rpl36 Rat furfural multiple interactions ISO RPL36 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Rpl36 Rat hydralazine multiple interactions ISO RPL36 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPL36 mRNA CTD PMID:17183730 Rpl36 Rat inulin multiple interactions ISO Rpl36 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of RPL36 mRNA CTD PMID:36331819 Rpl36 Rat ivermectin decreases expression ISO RPL36 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPL36 protein CTD PMID:32959892 Rpl36 Rat methylparaben decreases expression ISO RPL36 (Homo sapiens) 6480464 methylparaben results in decreased expression of RPL36 mRNA CTD PMID:38568856 Rpl36 Rat N-nitrosodiethylamine increases expression ISO Rpl36 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of RPL36 mRNA CTD PMID:12771043 Rpl36 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of RPL36 mRNA CTD PMID:19041683 Rpl36 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of RPL36 protein CTD PMID:19716841 Rpl36 Rat nitrates multiple interactions ISO Rpl36 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RPL36 mRNA CTD PMID:35964746 Rpl36 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of RPL36 mRNA CTD PMID:26720608 Rpl36 Rat paracetamol affects expression ISO Rpl36 (Mus musculus) 6480464 Acetaminophen affects the expression of RPL36 mRNA CTD PMID:17562736 Rpl36 Rat paracetamol increases expression ISO RPL36 (Homo sapiens) 6480464 Acetaminophen results in increased expression of RPL36 mRNA CTD PMID:29067470 Rpl36 Rat paracetamol multiple interactions ISO Rpl36 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RPL36 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RPL36 mRNA] CTD PMID:17585979 Rpl36 Rat parathion increases expression ISO Rpl36 (Mus musculus) 6480464 Parathion results in increased expression of RPL36 mRNA CTD PMID:34813904 Rpl36 Rat perfluorononanoic acid increases expression ISO RPL36 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of RPL36 mRNA CTD PMID:32588087 Rpl36 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rpl36 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL36 mRNA more ... CTD PMID:36331819 Rpl36 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of RPL36 mRNA CTD PMID:15215175 Rpl36 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RPL36 mRNA CTD PMID:15215175 Rpl36 Rat picoxystrobin increases expression ISO RPL36 (Homo sapiens) 6480464 picoxystrobin results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Rpl36 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of RPL36 mRNA CTD PMID:28903501 Rpl36 Rat pyrimidifen increases expression ISO RPL36 (Homo sapiens) 6480464 pyrimidifen results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat rotenone increases expression ISO RPL36 (Homo sapiens) 6480464 Rotenone results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat SB 431542 multiple interactions ISO RPL36 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RPL36 protein CTD PMID:37664457 Rpl36 Rat senecionine decreases expression ISO Rpl36 (Mus musculus) 6480464 senecionine results in decreased expression of RPL36 protein CTD PMID:35357534 Rpl36 Rat sodium arsenite decreases expression ISO RPL36 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPL36 mRNA and sodium arsenite results in decreased expression of RPL36 protein CTD PMID:30528433 and PMID:38568856 Rpl36 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RPL36 mRNA CTD PMID:35314868 Rpl36 Rat sodium chloride multiple interactions ISO RPL36 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of RPL36 protein more ... CTD PMID:38598786 Rpl36 Rat sodium fluoride decreases expression ISO Rpl36 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of RPL36 protein CTD PMID:28918527 Rpl36 Rat stigmasterol decreases expression ISO Rpl36 (Mus musculus) 6480464 Stigmasterol results in decreased expression of RPL36 mRNA CTD PMID:30245210 Rpl36 Rat sunitinib increases expression ISO RPL36 (Homo sapiens) 6480464 Sunitinib results in increased expression of RPL36 mRNA CTD PMID:31533062 Rpl36 Rat tebufenpyrad increases expression ISO RPL36 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of RPL36 mRNA CTD PMID:33512557 Rpl36 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of RPL36 mRNA CTD PMID:15963342 Rpl36 Rat titanium dioxide decreases methylation ISO Rpl36 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RPL36 gene CTD PMID:35295148 Rpl36 Rat tris(2-butoxyethyl) phosphate increases expression ISO RPL36 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate results in increased expression of RPL36 mRNA CTD PMID:29024780 Rpl36 Rat tungsten increases expression ISO Rpl36 (Mus musculus) 6480464 Tungsten results in increased expression of RPL36 mRNA CTD PMID:30912803 Rpl36 Rat valproic acid multiple interactions ISO RPL36 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPL36 mRNA CTD PMID:17183730 Rpl36 Rat valproic acid increases methylation ISO RPL36 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RPL36 gene CTD PMID:29154799 Rpl36 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RPL36 mRNA CTD PMID:23034163 Rpl36 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RPL36 mRNA CTD PMID:22615374
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,4-benzoquinone (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aconitine (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) azoxystrobin (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chloropicrin (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) cocaine (EXP) cyclosporin A (ISO) deguelin (ISO) dibutyl phthalate (EXP) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) fenpyroximate (ISO) fulvestrant (ISO) furfural (ISO) hydralazine (ISO) inulin (ISO) ivermectin (ISO) methylparaben (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosomorpholine (EXP) nitrates (ISO) nitrofen (EXP) paracetamol (ISO) parathion (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (EXP) picoxystrobin (ISO) pregnenolone 16alpha-carbonitrile (ISO) pyrimidifen (ISO) rotenone (ISO) SB 431542 (ISO) senecionine (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) stigmasterol (ISO) sunitinib (ISO) tebufenpyrad (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) tris(2-butoxyethyl) phosphate (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Structures of the human and Drosophila 80S ribosome.
Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.
The primary structure of rat ribosomal protein L36.
Chan YL, etal., Biochem Biophys Res Commun 1993 Apr 30;192(2):849-53.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Comprehensive gene review and curation
RGD comprehensive gene curation
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
10.
Isolation of eukaryotic ribosomal proteins. Purification and characterization of 60 S ribosomal subunit proteins L3, L6, L7', L8, L10, L15, L17, L18, L19, L23', L25, L27', L28, L29, L31, L32, L34, L35, L36, L36', and L37'.
Tsurugi K, etal., J Biol Chem. 1977 Jun 10;252(11):3961-9.
Rpl36 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,529,117 - 1,534,534 (+) NCBI GRCr8 mRatBN7.2 9 1,441,986 - 1,447,397 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 98,809,534 - 98,809,897 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 5 148,321,225 - 148,321,524 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 1,880,070 - 1,880,823 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,230,252 - 7,231,005 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,185,275 - 6,186,028 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,441,228 - 10,441,981 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,441,259 - 10,441,834 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,438,155 - 9,438,908 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 7,066,440 - 7,067,193 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
RPL36 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 5,690,295 - 5,691,875 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 5,674,947 - 5,691,875 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 5,690,306 - 5,691,886 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 5,641,272 - 5,642,678 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 5,641,366 - 5,642,676 NCBI Celera 19 5,627,643 - 5,629,049 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 5,451,041 - 5,452,447 (+) NCBI HuRef CHM1_1 19 5,689,881 - 5,691,287 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 5,676,985 - 5,678,565 (+) NCBI T2T-CHM13v2.0
Rpl36 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 56,917,094 - 56,921,246 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 56,920,416 - 56,921,243 (+) Ensembl GRCm39 Ensembl GRCm38 17 56,610,094 - 56,614,246 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 56,613,416 - 56,614,243 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 56,752,818 - 56,753,669 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 56,298,553 - 56,299,366 (+) NCBI MGSCv36 mm8 Celera 17 60,957,594 - 60,958,445 (+) NCBI Celera Cytogenetic Map 17 D NCBI cM Map 17 29.42 NCBI
Rpl36 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 3,729,626 - 3,731,043 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 3,729,626 - 3,731,043 (-) NCBI ChiLan1.0 ChiLan1.0
RPL36 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 10,086,603 - 10,088,233 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 9,312,923 - 9,314,419 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 4,707,396 - 4,708,897 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 5,643,030 - 5,644,360 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 5,643,030 - 5,644,360 (+) Ensembl panpan1.1 panPan2
RPL36 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 54,334,256 - 54,335,169 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 54,060,978 - 54,061,750 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 54,989,877 - 54,990,655 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 54,989,848 - 54,990,617 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 54,052,260 - 54,053,143 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 54,532,877 - 54,533,648 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 54,730,153 - 54,730,916 (-) NCBI UU_Cfam_GSD_1.0
Rpl36 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 214,569,528 - 214,570,479 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 3,264,356 - 3,265,244 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 3,264,356 - 3,265,255 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPL36 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 73,286,903 - 73,288,489 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 73,286,906 - 73,288,512 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 73,808,887 - 73,810,493 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPL36
Rpl36
.
Predicted Target Of
Count of predictions: 24 Count of miRNA genes: 24 Interacting mature miRNAs: 24 Transcripts: ENSRNOT00000043704 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000043704 ⟹ ENSRNOP00000058934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 9 10,441,259 - 10,441,834 (-) Ensembl
RefSeq Acc Id:
NM_022504 ⟹ NP_071949
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 1,533,780 - 1,534,533 (+) NCBI mRatBN7.2 9 1,446,643 - 1,447,396 (+) NCBI Rnor_6.0 9 10,441,228 - 10,441,981 (-) NCBI Rnor_5.0 9 9,438,155 - 9,438,908 (-) NCBI Celera 9 7,066,440 - 7,067,193 (-) RGD
Sequence:
CGGAAAGCTGCAGCCATGGCCCTGCGCTACCCCATGGCCGTGGGCCTCAACAAAGGCCACAAAGTGACGAAAAACGTCAGCAAGCCGAGACACAGCCGCCGCCGCGGGCGCCTCACCAAGCACACCAA
hide sequence
RefSeq Acc Id:
XM_039084146 ⟹ XP_038940074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 1,529,117 - 1,534,534 (+) NCBI mRatBN7.2 9 1,441,986 - 1,447,397 (+) NCBI
RefSeq Acc Id:
NP_071949 ⟸ NM_022504
- UniProtKB:
Q6PDV5 (UniProtKB/Swiss-Prot), P39032 (UniProtKB/Swiss-Prot), A0A0G2K6X1 (UniProtKB/TrEMBL)
- Sequence:
MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCAFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD
hide sequence
Ensembl Acc Id:
ENSRNOP00000058934 ⟸ ENSRNOT00000043704
RefSeq Acc Id:
XP_038940074 ⟸ XM_039084146
- Peptide Label:
isoform X1
- UniProtKB:
A6KQW5 (UniProtKB/TrEMBL), A0A0G2K6X1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Rpl36
ribosomal protein L36
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_protein
104 amino acids
61735
