Advanced Search (OLGA)

Gene: Zp3 (zona pellucida glycoprotein 3) Rattus norvegicus

Analyze

Symbol:

Zp3

Name:

zona pellucida glycoprotein 3

RGD ID:

620606

Description:

Predicted to enable several functions, including acrosin binding activity; identical protein binding activity; and receptor ligand activity. Predicted to be a structural constituent of egg coat. Predicted to be involved in several processes, including oogenesis; positive regulation of immune response; and regulation of gene expression. Predicted to be located in extracellular matrix and plasma membrane. Predicted to be active in egg coat and extracellular space. Orthologous to human ZP3 (zona pellucida glycoprotein 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

zona pellucida glycoprotein 3 (sperm receptor); zona pellucida glycoprotein ZP3; zona pellucida protein C; zona pellucida sperm-binding protein 3; Zp-3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZP3 (zona pellucida glycoprotein 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	POMZP3 (POM121 and ZP3 fusion)	HGNC	Ensembl, OrthoDB
Homo sapiens (human):	LNX2 (ligand of numb-protein X 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Zp3 (zona pellucida glycoprotein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ZP3 (zona pellucida glycoprotein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3b (zona pellucida glycoprotein 3b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	zp3b (zona pellucida glycoprotein 3b)	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	zp3a.1 (zona pellucida glycoprotein 3a, tandem duplicate 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:173556	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:173556	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3a.2 (zona pellucida glycoprotein 3a, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3a.2 (zona pellucida glycoprotein 3a, tandem duplicate 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3.2 (zona pellucida glycoprotein 3, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3.2 (zona pellucida glycoprotein 3, tandem duplicate 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3 (zona pellucida glycoprotein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3e	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3e	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zp3 [provisional]	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zp3 [provisional]	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,327,161 - 26,334,126 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	26,327,161 - 26,334,126 (-)	Ensembl				GRCr8
mRatBN7.2	12	20,690,547 - 20,697,513 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	20,690,547 - 20,697,513 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	21,831,035 - 21,838,010 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,443,745 - 22,450,720 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,508,864 - 21,516,408 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	23,735,225 - 23,752,734 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	23,735,223 - 23,742,190 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	25,733,873 - 25,740,838 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	21,805,746 - 21,812,711 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	22,453,873 - 22,460,838 (-)	NCBI		Celera
RGSC_v3.1	12	21,792,837 - 21,799,583 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Oocyte Maturation Defect 3 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bexarotene (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

dexamethasone (EXP)

diclofenac (ISO)

ethylparaben (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

ibuprofen (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

N-methyl-4-phenylpyridinium (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sulforaphane (ISO)

temozolomide (ISO)

testosterone (EXP)

titanium dioxide (ISO)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

binding of sperm to zona pellucida (IBA,IEA,ISO,ISS)

blastocyst formation (IEA,ISO,ISS)

egg coat formation (IBA,IEA,ISO,ISS)

humoral immune response mediated by circulating immunoglobulin (IEA,ISO,ISS)

negative regulation of binding of sperm to zona pellucida (ISO,ISS)

negative regulation of DNA-templated transcription (IEA,ISO,ISS)

oocyte development (IEA,ISO,ISS)

positive regulation of acrosomal vesicle exocytosis (ISO,ISS)

positive regulation of acrosome reaction (IBA,IEA,ISO,ISS)

positive regulation of antral ovarian follicle growth (IEA,ISO,ISS)

positive regulation of DNA-templated transcription (IEA,ISO,ISS)

positive regulation of humoral immune response (ISO,ISS)

positive regulation of inflammatory response (IEA,ISO,ISS)

positive regulation of interleukin-4 production (IEA,ISO,ISS)

positive regulation of leukocyte migration (IEA,ISO,ISS)

positive regulation of ovarian follicle development (IEA,ISO,ISS)

positive regulation of T cell proliferation (IEA,ISO,ISS)

positive regulation of type II interferon production (IEA,ISO,ISS)

positive regulation of type IV hypersensitivity (IEA,ISO,ISS)

regulation of signaling receptor activity (ISO)

signal transduction (IEA)

single fertilization (IEA)

Cellular Component

egg coat (IBA,IEA,ISO,ISS)

extracellular matrix (IEA,ISO,ISS)

extracellular space (IBA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

Molecular Function

acrosin binding (IBA,ISO)

carbohydrate binding (ISO,ISS)

identical protein binding (ISO)

protein binding (ISO)

receptor ligand activity (IEA,ISO,ISS)

structural constituent of egg coat (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat zona pellucida glycoproteins: molecular cloning and characterization of the three major components.	Akatsuka K, etal., Mol Reprod Dev 1998 Dec;51(4):454-67.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9374408	PMID:9609824	PMID:10793136	PMID:11417900	PMID:11739644	PMID:11751269	PMID:11906903	PMID:12052239	PMID:12477932	PMID:14645511	PMID:15579591	PMID:15950651
PMID:16342937	PMID:17047254	PMID:17258189	PMID:18420282	PMID:18667750	PMID:18667753	PMID:19004505	PMID:19052627	PMID:19246320	PMID:19700799	PMID:20382503	PMID:20394732
PMID:26879157	PMID:28886344	PMID:29895852	PMID:33624742

Genomics

Comparative Map Data

Zp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,327,161 - 26,334,126 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	26,327,161 - 26,334,126 (-)	Ensembl				GRCr8
mRatBN7.2	12	20,690,547 - 20,697,513 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	20,690,547 - 20,697,513 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	21,831,035 - 21,838,010 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,443,745 - 22,450,720 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,508,864 - 21,516,408 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	23,735,225 - 23,752,734 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	23,735,223 - 23,742,190 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	25,733,873 - 25,740,838 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	21,805,746 - 21,812,711 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	22,453,873 - 22,460,838 (-)	NCBI		Celera
RGSC_v3.1	12	21,792,837 - 21,799,583 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

ZP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	76,397,522 - 76,442,069 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	76,397,518 - 76,442,071 (+)	Ensembl			hg38	GRCh38
GRCh37	7	76,026,839 - 76,071,386 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	75,864,804 - 75,909,324 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	75,671,518 - 75,716,038	NCBI
Celera	7	70,895,359 - 70,931,910 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	71,113,333 - 71,158,989 (+)	NCBI		HuRef
CHM1_1	7	75,957,109 - 76,001,648 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	77,685,187 - 77,730,456 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	75,359,905 - 75,404,452 (+)	NCBI

Zp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	136,008,959 - 136,017,478 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	136,008,953 - 136,017,478 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	135,980,105 - 135,988,624 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,980,099 - 135,988,624 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	136,455,975 - 136,464,494 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	136,264,732 - 136,273,251 (+)	NCBI		MGSCv36	mm8
Celera	5	132,991,486 - 133,024,448 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.62	NCBI

Zp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	15,013,811 - 15,020,816 (+)	Ensembl
ChiLan1.0	NW_004955456	15,013,472 - 15,020,809 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	93,508,359 - 93,526,170 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	141,772,997 - 141,790,809 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	67,574,932 - 67,592,757 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	82,872,676 - 82,891,655 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	82,844,162 - 82,891,655 (+)	Ensembl			panPan2	panpan1.1

ZP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	7,586,212 - 7,594,610 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	7,585,970 - 7,594,610 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	9,281,828 - 9,290,191 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	7,406,839 - 7,415,182 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	7,406,839 - 7,415,182 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	7,375,722 - 7,384,085 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	7,338,676 - 7,347,061 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	7,501,843 - 7,510,213 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Zp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	132,014,297 - 132,023,299 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,013,228 - 2,020,077 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,013,231 - 2,022,270 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	9,934,760 - 9,944,941 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	9,934,760 - 9,944,924 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	9,837,980 - 9,848,145 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	3	pter-p15	NCBI

ZP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	10,534,383 - 10,579,828 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	10,562,455 - 10,579,825 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	5,838,035 - 5,855,397 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	15,037,943 - 15,044,193 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	15,037,818 - 15,044,207 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Zp3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	18,030,729 - 18,037,628 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Zp3
46 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	52
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000001952
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	1	2	59	19	18	3	21	3	1	46	28	2	55	10	49	15	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001952 ⟹ ENSRNOP00000001952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	26,327,161 - 26,334,126 (-)	Ensembl
mRatBN7.2 Ensembl	12	20,690,547 - 20,697,513 (-)	Ensembl
Rnor_6.0 Ensembl	12	23,735,223 - 23,742,190 (-)	Ensembl

RefSeq Acc Id:

NM_053762 ⟹ NP_446214

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	26,327,161 - 26,334,126 (-)	NCBI
mRatBN7.2	12	20,690,547 - 20,697,513 (-)	NCBI
Rnor_6.0	12	23,735,225 - 23,742,190 (-)	NCBI
Rnor_5.0	12	25,733,873 - 25,740,838 (-)	NCBI
RGSC_v3.4	12	21,805,746 - 21,812,711 (-)	RGD
Celera	12	22,453,873 - 22,460,838 (-)	RGD

Sequence:

show sequence

CTGCGCCCGGCTGCATCCCAGGGAGCACCATGGGGCCCAGCTGTCTACTCTTCCTGTGTCTCCT
GCTGTGCGGAGGCCCAGAACTGTGCTATCCCCAGACTCAATGGCTTTTACCGGGTGGAACCCCC
ACCCCAGCGGGGTCCTCATCACCTGTGGAGGTGGAGTGTAAGGAAGCTGAGCTAGTGGTGACTG
CCCGTAGAGACCTTTTTGGCACAGGGAAGCTCGTGCAGCCCGGGGACCTCACCCTTGGCTCAGA
AGGCTGTCAGCCCCTCGTAGCAGTGGATACTGACGTAGTCAGGCTCAACGCCCAGTTGCATGAA
TGCAGCAGCGGGGTGCAGGTGACAGAAGACGCCCTGGTGTACAGCACCTTTCTGCTCCACGACC
CTCGCCCTGTGAATGGCCTGTCTATCCTAAGGACTAACCGGGTGGAGGTCCCCATTGAGTGCCG
ATACCCCAGGCAGGGCAATGTGAGCAGCCACCCTATCCAACCCACCTGGGTTCCCTTCAGCGCT
ACTGTGTCCTCGGAGGAGAAACTGGCTTTCTCTCTTCGTCTGATGGAGGAGGACTGGAATACTG
AGAAATCATCTCCCACCTTCCACCTGGGAGAGGTAGCCCACCTCCAGGCGGAAGTCCAGACCGG
AAGCCACCTGCCTCTGCAGTTGTTTGTGGACCACTGCGTGGCCACGCCTTCACCGTTGCCAGGC
CAGAACTCCTCCCCCCATCACTTCATCGTGGACTCCCATGGATGCCTTGTGGACGGTCTATCTG
AGAGCTTTTCAGCATTTCAAGTCCCTAGACCCCGGCCAGAGACTCTGCAGTTCACAGTGGACGT
ATTCCATTTCGCCAACAGCTCCAGAAATACGGTTTACATCACCTGCCATCTCAAAGTCGCTCCA
GCTAACCAGATCCCCGATAAGCTCAACAAAGCCTGTTCCTTCAACAAGACTTCCCAGAGTTGGT
TGCCAGTAGAGGGCGATGCTGACATCTGTGATTGCTGCAGCAATGGCAACTGTAGTAATTCAAG
CTCTTCAGAGTTCGAGACCCATGAACCAGCCCAGTGGTCCACGCTAGTTTCTCGAAACCGCAGG
CACGTGACGGATGAAGCTGATGTCACTGTAGGGCCCCTGATATTCCTTGGAAAAGCAAATGACC
AGGCTGTGGAGGGCTGGACCTCTTCTGCTCAAACCTCTGTGGCTCTCGGCTTAGGCTTGGCCAC
AGTGGCATTCCTGACCCTGGCTGCTATTGTCCTTGGTGTCACCAGGATGTGTCACACCTCTTCC
TACCTTGTATCCCTTCCTCAATAAAAGAAGCTCAGTTCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_446214	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI27489	(Get FASTA)	NCBI Sequence Viewer
	BAA24456	(Get FASTA)	NCBI Sequence Viewer
	EDM13334	(Get FASTA)	NCBI Sequence Viewer
	EDM13335	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001952
GenBank Protein	P97708	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446214 ⟸ NM_053762
- Peptide Label:	precursor
- UniProtKB:	A1L124 (UniProtKB/TrEMBL), F7EZ23 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPSCLLFLCLLLCGGPELCYPQTQWLLPGGTPTPAGSSSPVEVECKEAELVVTARRDLFGTGK LVQPGDLTLGSEGCQPLVAVDTDVVRLNAQLHECSSGVQVTEDALVYSTFLLHDPRPVNGLSIL RTNRVEVPIECRYPRQGNVSSHPIQPTWVPFSATVSSEEKLAFSLRLMEEDWNTEKSSPTFHLG EVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPGQNSSPHHFIVDSHGCLVDGLSESFSAFQVPR PRPETLQFTVDVFHFANSSRNTVYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADIC DCCSNGNCSNSSSSEFETHEPAQWSTLVSRNRRHVTDEADVTVGPLIFLGKANDQAVEGWTSSA QTSVALGLGLATVAFLTLAAIVLGVTRMCHTSSYLVSLPQ hide sequence

Ensembl Acc Id:

ENSRNOP00000001952 ⟸ ENSRNOT00000001952

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97708-F1-model_v2	AlphaFold	P97708	1-424	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620606	AgrOrtholog
BioCyc Gene	G2FUF-19643	BioCyc
Ensembl Genes	ENSRNOG00000001434	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000001952	ENTREZGENE
Gene3D-CATH	2.60.40.4100	UniProtKB/Swiss-Prot
	Zona pellucida, ZP-N domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7308805	IMAGE-MGC_LOAD
InterPro	ZP-C	UniProtKB/Swiss-Prot
	ZP-C	UniProtKB/Swiss-Prot
	ZP-N	UniProtKB/Swiss-Prot
	ZP_chr	UniProtKB/Swiss-Prot
	ZP_dom	UniProtKB/Swiss-Prot
	ZP_dom_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:114639	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156611	IMAGE-MGC_LOAD
NCBI Gene	114639	ENTREZGENE
PANTHER	PTHR11576:SF2	UniProtKB/Swiss-Prot
	ZONA PELLUCIDA SPERM-BINDING PROTEIN 3	UniProtKB/Swiss-Prot
Pfam	Zona_pellucida	UniProtKB/Swiss-Prot
	ZP-N	UniProtKB/Swiss-Prot
PhenoGen	Zp3	PhenoGen
PRINTS	ZPELLUCIDA	UniProtKB/Swiss-Prot
PROSITE	ZP_1	UniProtKB/Swiss-Prot
	ZP_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001434	RatGTEx
SMART	SM00241	UniProtKB/Swiss-Prot
UniProt	A1L124	ENTREZGENE, UniProtKB/TrEMBL
	A6J096_RAT	UniProtKB/TrEMBL
	F7EZ23	ENTREZGENE, UniProtKB/TrEMBL
	P97708	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	O55084	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-18	Zp3	zona pellucida glycoprotein 3	Zp3	zona pellucida glycoprotein 3 (sperm receptor)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Zp3	zona pellucida glycoprotein 3 (sperm receptor)	Zp3	zona pellucida glycoprotein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Zp3	zona pellucida glycoprotein 3			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Zp3	zona pellucida glycoprotein 3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains six potential N-glycosylation sites and 75 Ser/Thr residues which are possible O-glycosylation sites	634535

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM