Symbol:
Plpp3
Name:
phospholipid phosphatase 3
RGD ID:
620454
Description:
Predicted to enable delta-catenin binding activity; integrin binding activity; and lipid phosphatase activity. Predicted to be involved in several processes, including positive regulation of cell adhesion; regulation of DNA-templated transcription; and sphingolipid metabolic process. Predicted to act upstream of or within several processes, including Bergmann glial cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; and regulation of signal transduction. Located in endoplasmic reticulum membrane. Orthologous to human PLPP3 (phospholipid phosphatase 3); PARTICIPATES IN ether lipid metabolic pathway; ether lipid metabolic pathway; Fc gamma receptor mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
differentially expressed in rat intestine; differentially expressed in rat intestine 42; Dri42; ER transmembrane protein Dri 42; lipid phosphate phosphohydrolase 3; PAP-2b; PAP2-beta; PAP2b; phosphatidate phosphohydrolase type 2b; phosphatidic acid phosphatase 2b; phosphatidic acid phosphatase type 2B; Ppap2b
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLPP3 (phospholipid phosphatase 3)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Plpp3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plpp3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLPP3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLPP3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plpp3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLPP3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLPP3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plpp3 (phospholipid phosphatase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Plpp3 (phospholipid phosphatase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLPP3 (phospholipid phosphatase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
plpp3 (phospholipid phosphatase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11425
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
plpp-1.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11426
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11437
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG11438
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
wun
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
laza
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
wun2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
plpp3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 125,156,000 - 125,231,119 (+) NCBI GRCr8 mRatBN7.2 5 119,927,085 - 120,002,206 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 119,927,085 - 120,002,205 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 122,548,651 - 122,624,021 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 124,271,713 - 124,347,083 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 124,322,955 - 124,398,328 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 124,690,214 - 124,765,499 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 124,690,214 - 124,765,498 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 128,551,196 - 128,626,138 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 126,121,416 - 126,197,099 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 126,126,641 - 126,202,324 (+) NCBI Celera 5 118,477,102 - 118,551,973 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plpp3 Rat (-)-demecolcine increases expression ISO PLPP3 (Homo sapiens) 6480464 Demecolcine results in increased expression of PLPP3 mRNA CTD PMID:23649840 Plpp3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLPP3 mRNA CTD PMID:22079256 Plpp3 Rat (1->4)-beta-D-glucan multiple interactions ISO Plpp3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PLPP3 mRNA CTD PMID:36331819 Plpp3 Rat 1,2-dichloroethane increases expression ISO Plpp3 (Mus musculus) 6480464 ethylene dichloride results in increased expression of PLPP3 mRNA and ethylene dichloride results in increased expression of PPAP2B mRNA CTD PMID:28189721 and PMID:28960355 Plpp3 Rat 1,2-dimethylhydrazine multiple interactions ISO Plpp3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PLPP3 mRNA CTD PMID:22206623 Plpp3 Rat 17alpha-ethynylestradiol affects expression ISO Plpp3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PLPP3 mRNA CTD PMID:17555576 Plpp3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PLPP3 mRNA CTD PMID:17557909 Plpp3 Rat 17beta-estradiol multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PLPP3 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of PLPP3 mRNA CTD PMID:19619570 and PMID:30165855 Plpp3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PPAP2B mRNA CTD PMID:32145629 Plpp3 Rat 17beta-estradiol increases expression ISO PLPP3 (Homo sapiens) 6480464 Estradiol results in increased expression of PLPP3 mRNA CTD PMID:23019147 Plpp3 Rat 17beta-estradiol decreases expression ISO PLPP3 (Homo sapiens) 6480464 Estradiol results in decreased expression of PLPP3 mRNA CTD PMID:16474171 and PMID:19619570 Plpp3 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PLPP3 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PLPP3 mRNA CTD PMID:29581250 Plpp3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PLPP3 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Plpp3 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Plpp3 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PLPP3 mRNA CTD PMID:19619570 Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLPP3 mRNA CTD PMID:33387578 Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PLPP3 mRNA CTD PMID:34747641 Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plpp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLPP3 mRNA CTD PMID:16962184 more ... Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PLPP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLPP3 mRNA CTD PMID:11007951 more ... Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Plpp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLPP3 mRNA CTD PMID:18796159 more ... Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLPP3 mRNA CTD PMID:19490992 Plpp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Plpp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of PLPP3 mRNA CTD PMID:16214954 Plpp3 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Plpp3 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Plpp3 Rat 2-amino-2-deoxy-D-glucopyranose decreases expression EXP 6480464 Glucosamine results in decreased expression of PLPP3 mRNA CTD PMID:17109745 Plpp3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Plpp3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO PLPP3 (Homo sapiens) 6480464 3 more ... CTD PMID:29947894 Plpp3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLPP3 mRNA CTD PMID:28628672 Plpp3 Rat 3-methylcholanthrene decreases expression ISO Plpp3 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of PLPP3 mRNA CTD PMID:20713471 Plpp3 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PLPP3 mRNA CTD PMID:19162173 Plpp3 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Plpp3 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PLPP3 mRNA CTD PMID:18648102 Plpp3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Plpp3 (Mus musculus) 6480464 bisphenol S results in decreased expression of PLPP3 mRNA CTD PMID:39298647 Plpp3 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid increases expression ISO PLPP3 (Homo sapiens) 6480464 Am 580 results in increased expression of PLPP3 mRNA CTD PMID:16982809 Plpp3 Rat 6alpha-methylprednisolone decreases expression ISO PLPP3 (Homo sapiens) 6480464 Methylprednisolone results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PLPP3 mRNA CTD PMID:31881176 Plpp3 Rat aflatoxin B1 increases expression ISO Plpp3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PLPP3 mRNA CTD PMID:19770486 Plpp3 Rat aflatoxin B1 decreases methylation ISO PLPP3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PLPP3 gene CTD PMID:27153756 Plpp3 Rat aldehydo-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of PLPP3 mRNA CTD PMID:17109745 Plpp3 Rat all-trans-retinoic acid decreases expression ISO PLPP3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PLPP3 mRNA CTD PMID:23724009 Plpp3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLPP3 mRNA CTD PMID:38685447 Plpp3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLPP3 mRNA CTD PMID:16483693 Plpp3 Rat arsane affects methylation ISO PLPP3 (Homo sapiens) 6480464 Arsenic affects the methylation of PLPP3 gene CTD PMID:25304211 Plpp3 Rat arsane multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat arsenic atom affects methylation ISO PLPP3 (Homo sapiens) 6480464 Arsenic affects the methylation of PLPP3 gene CTD PMID:25304211 Plpp3 Rat arsenic atom multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat arsenous acid increases expression ISO PLPP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PLPP3 mRNA CTD PMID:19128835 Plpp3 Rat ATP decreases chemical synthesis ISO Plpp3 (Mus musculus) 6480464 PLPP3 gene mutant form results in decreased chemical synthesis of Adenosine Triphosphate CTD PMID:28982073 Plpp3 Rat azathioprine decreases expression ISO PLPP3 (Homo sapiens) 6480464 Azathioprine results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat benzene increases expression ISO PLPP3 (Homo sapiens) 6480464 Benzene results in increased expression of PLPP3 mRNA CTD PMID:19162166 Plpp3 Rat benzo[a]pyrene increases expression ISO Plpp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PLPP3 mRNA CTD PMID:19770486 Plpp3 Rat benzo[a]pyrene affects methylation ISO PLPP3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PLPP3 promoter CTD PMID:27901495 Plpp3 Rat benzo[a]pyrene decreases expression ISO PLPP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PLPP3 mRNA CTD PMID:20064835 more ... Plpp3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PLPP3 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Plpp3 Rat beta-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of PLPP3 mRNA CTD PMID:17109745 Plpp3 Rat beta-lapachone decreases expression ISO PLPP3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PLPP3 mRNA CTD PMID:38218311 Plpp3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Plpp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PLPP3 mRNA CTD PMID:33754040 Plpp3 Rat bisphenol A decreases expression ISO PLPP3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLPP3 mRNA CTD PMID:16474171 Plpp3 Rat bisphenol A decreases methylation ISO PLPP3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PLPP3 gene CTD PMID:31601247 Plpp3 Rat bisphenol A increases expression ISO PLPP3 (Homo sapiens) 6480464 bisphenol A results in increased expression of PLPP3 mRNA CTD PMID:29275510 Plpp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLPP3 mRNA and bisphenol A results in decreased expression of PPAP2B mRNA CTD PMID:30816183 more ... Plpp3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PPAP2B mRNA CTD PMID:30903817 Plpp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLPP3 mRNA CTD PMID:25181051 Plpp3 Rat bisphenol A multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLPP3 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLPP3 mRNA CTD PMID:28628672 and PMID:31601247 Plpp3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PLPP3 gene CTD PMID:28505145 Plpp3 Rat bisphenol AF increases expression ISO PLPP3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PLPP3 protein CTD PMID:34186270 Plpp3 Rat Bisphenol B increases expression ISO PLPP3 (Homo sapiens) 6480464 bisphenol B results in increased expression of PLPP3 protein CTD PMID:34186270 Plpp3 Rat bisphenol F increases expression ISO PLPP3 (Homo sapiens) 6480464 bisphenol F results in increased expression of PLPP3 protein CTD PMID:34186270 Plpp3 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat Butylbenzyl phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat cadmium atom multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PLPP3 mRNA CTD PMID:35301059 Plpp3 Rat cadmium dichloride increases expression ISO PLPP3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PPAP2B mRNA CTD PMID:38382870 Plpp3 Rat cadmium dichloride multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PLPP3 mRNA CTD PMID:35301059 Plpp3 Rat cadmium sulfate multiple interactions ISO Plpp3 (Mus musculus) 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of PLPP3 mRNA] CTD PMID:16221973 Plpp3 Rat calyculin a increases expression ISO Plpp3 (Mus musculus) 6480464 calyculin A results in increased expression of PLPP3 mRNA CTD PMID:25270620 Plpp3 Rat cannabidiol increases expression ISO Plpp3 (Mus musculus) 6480464 Cannabidiol results in increased expression of PLPP3 mRNA CTD PMID:21542829 Plpp3 Rat carbon nanotube decreases expression ISO Plpp3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plpp3 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of PLPP3 mRNA CTD PMID:23125180 Plpp3 Rat choline multiple interactions ISO Plpp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PLPP3 mRNA CTD PMID:20938992 Plpp3 Rat cisplatin decreases expression ISO PLPP3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PLPP3 mRNA CTD PMID:27392435 Plpp3 Rat cisplatin multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PLPP3 mRNA CTD PMID:27392435 Plpp3 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PLPP3 mRNA CTD PMID:17602206 Plpp3 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PLPP3 mRNA CTD PMID:24386269 Plpp3 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PLPP3 mRNA CTD PMID:17898221 Plpp3 Rat copper(II) sulfate decreases expression ISO PLPP3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PLPP3 mRNA CTD PMID:19549813 Plpp3 Rat crocidolite asbestos affects expression ISO PLPP3 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of PLPP3 mRNA CTD PMID:24160326 Plpp3 Rat crocidolite asbestos increases expression ISO PLPP3 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PLPP3 mRNA CTD PMID:18687144 and PMID:25757056 Plpp3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PLPP3 mRNA CTD PMID:27523638 Plpp3 Rat cyclosporin A decreases expression ISO PLPP3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PLPP3 mRNA CTD PMID:20106945 more ... Plpp3 Rat dexamethasone multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLPP3 mRNA CTD PMID:28628672 Plpp3 Rat diallyl disulfide multiple interactions ISO PLPP3 (Homo sapiens) 6480464 diallyl disulfide inhibits the reaction [tobacco tar analog results in decreased expression of PPAP2B mRNA] CTD PMID:36758788 Plpp3 Rat diarsenic trioxide increases expression ISO PLPP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PLPP3 mRNA CTD PMID:19128835 Plpp3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PLPP3 mRNA CTD PMID:21266533 Plpp3 Rat dibutyl phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of PLPP3 mRNA CTD PMID:23153324 Plpp3 Rat diethyl phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat diisobutyl phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat diisononyl phthalate multiple interactions ISO Plpp3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLPP3 mRNA CTD PMID:39150890 Plpp3 Rat dioxygen decreases metabolic processing ISO Plpp3 (Mus musculus) 6480464 PLPP3 gene mutant form results in decreased metabolism of Oxygen CTD PMID:28982073 Plpp3 Rat dioxygen multiple interactions ISO Plpp3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PPAP2B mRNA CTD PMID:30529165 Plpp3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PLPP3 mRNA CTD PMID:25152437 Plpp3 Rat divanadium pentaoxide affects expression ISO Plpp3 (Mus musculus) 6480464 vanadium pentoxide affects the expression of PLPP3 mRNA CTD PMID:26210822 Plpp3 Rat doxorubicin decreases expression ISO PLPP3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLPP3 mRNA CTD PMID:29803840 Plpp3 Rat elemental selenium decreases expression ISO PLPP3 (Homo sapiens) 6480464 Selenium results in decreased expression of PLPP3 mRNA CTD PMID:19244175 Plpp3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PLPP3 mRNA CTD PMID:29391264 Plpp3 Rat entinostat increases expression ISO PLPP3 (Homo sapiens) 6480464 entinostat results in increased expression of PLPP3 mRNA CTD PMID:27188386 Plpp3 Rat epoxiconazole decreases expression ISO Plpp3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PLPP3 mRNA CTD PMID:35436446 Plpp3 Rat ethanol increases expression ISO Plpp3 (Mus musculus) 6480464 Ethanol results in increased expression of PLPP3 mRNA and Ethanol results in increased expression of PPAP2B mRNA CTD PMID:19167417 and PMID:30319688 Plpp3 Rat ethanol affects splicing ISO Plpp3 (Mus musculus) 6480464 Ethanol affects the splicing of PLPP3 mRNA CTD PMID:30319688 Plpp3 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PLPP3 mRNA CTD PMID:23962444 Plpp3 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PLPP3 mRNA CTD PMID:31881178 Plpp3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat folic acid multiple interactions ISO Plpp3 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Plpp3 Rat folic acid decreases expression ISO Plpp3 (Mus musculus) 6480464 Folic Acid results in decreased expression of PPAP2B mRNA CTD PMID:25629700 Plpp3 Rat formaldehyde increases expression ISO PLPP3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of PLPP3 mRNA CTD PMID:23649840 Plpp3 Rat FR900359 decreases phosphorylation ISO PLPP3 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of PLPP3 protein CTD PMID:37730182 Plpp3 Rat fulvestrant multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLPP3 gene CTD PMID:31601247 Plpp3 Rat furan decreases expression EXP 6480464 furan results in decreased expression of PLPP3 mRNA CTD PMID:25539665 Plpp3 Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of PLPP3 mRNA CTD PMID:17785943 Plpp3 Rat genistein decreases expression ISO PLPP3 (Homo sapiens) 6480464 Genistein results in decreased expression of PLPP3 mRNA CTD PMID:16474171 Plpp3 Rat genistein increases expression ISO PLPP3 (Homo sapiens) 6480464 Genistein results in increased expression of PLPP3 mRNA CTD PMID:23019147 Plpp3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PLPP3 mRNA CTD PMID:33387578 Plpp3 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat graphite affects expression EXP 6480464 Graphite affects the expression of PLPP3 mRNA CTD PMID:29933104 Plpp3 Rat hydrogen chloride decreases expression ISO PLPP3 (Homo sapiens) 6480464 Hydrochloric Acid results in decreased expression of PLPP3 mRNA CTD PMID:15046208 Plpp3 Rat hydrogen peroxide affects expression ISO PLPP3 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PLPP3 mRNA CTD PMID:20044591 Plpp3 Rat indometacin multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLPP3 mRNA CTD PMID:28628672 Plpp3 Rat isoflavones affects expression ISO PLPP3 (Homo sapiens) 6480464 Isoflavones affects the expression of PLPP3 mRNA CTD PMID:16365062 Plpp3 Rat isotretinoin increases expression ISO PLPP3 (Homo sapiens) 6480464 Isotretinoin results in increased expression of PLPP3 mRNA CTD PMID:20436886 Plpp3 Rat L-methionine multiple interactions ISO Plpp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PLPP3 mRNA CTD PMID:20938992 Plpp3 Rat lead diacetate increases expression ISO Plpp3 (Mus musculus) 6480464 lead acetate results in increased expression of PLPP3 mRNA CTD PMID:20542052 Plpp3 Rat manganese atom multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat manganese(0) multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat manganese(II) chloride multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat metacetamol decreases expression ISO Plpp3 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of PLPP3 mRNA CTD PMID:18544908 Plpp3 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PPAP2B mRNA CTD PMID:30467583 Plpp3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PPAP2B mRNA CTD PMID:30047161 Plpp3 Rat methotrexate increases expression ISO PLPP3 (Homo sapiens) 6480464 Methotrexate results in increased expression of PLPP3 mRNA CTD PMID:17400583 Plpp3 Rat methotrexate decreases expression ISO PLPP3 (Homo sapiens) 6480464 Methotrexate results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat methylmercury chloride decreases expression ISO PLPP3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLPP3 mRNA CTD PMID:28001369 Plpp3 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PLPP3 mRNA CTD PMID:20360939 Plpp3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PLPP3 mRNA CTD PMID:17602206 Plpp3 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PLPP3 mRNA CTD PMID:22110744 Plpp3 Rat nickel dichloride increases expression ISO PLPP3 (Homo sapiens) 6480464 nickel chloride results in increased expression of PLPP3 mRNA CTD PMID:17312168 Plpp3 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PLPP3 mRNA CTD PMID:25729387 Plpp3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLPP3 mRNA CTD PMID:25729387 Plpp3 Rat ozone multiple interactions ISO Plpp3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PLPP3 mRNA CTD PMID:34911549 Plpp3 Rat paracetamol decreases expression ISO Plpp3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of PLPP3 mRNA CTD PMID:18544908 Plpp3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PLPP3 mRNA CTD PMID:33387578 Plpp3 Rat paracetamol decreases expression ISO PLPP3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLPP3 mRNA and Acetaminophen results in decreased expression of PPAP2B mRNA CTD PMID:21420995 and PMID:29067470 Plpp3 Rat paracetamol affects expression ISO Plpp3 (Mus musculus) 6480464 Acetaminophen affects the expression of PLPP3 mRNA CTD PMID:17562736 Plpp3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Plpp3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PLPP3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PLPP3 mRNA CTD PMID:36331819 Plpp3 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PLPP3 mRNA CTD PMID:19162173 Plpp3 Rat perfluorooctanoic acid decreases expression ISO PLPP3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PLPP3 mRNA CTD PMID:37738295 Plpp3 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PLPP3 mRNA CTD PMID:19162173 Plpp3 Rat pirinixic acid multiple interactions ISO Plpp3 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PLPP3 mRNA CTD PMID:19710929 Plpp3 Rat piroxicam decreases expression ISO PLPP3 (Homo sapiens) 6480464 Piroxicam results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat potassium chromate multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLPP3 mRNA CTD PMID:22079256 Plpp3 Rat potassium chromate decreases expression ISO PLPP3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PLPP3 mRNA CTD PMID:22079256 Plpp3 Rat prednisolone decreases expression ISO PLPP3 (Homo sapiens) 6480464 Prednisolone results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PLPP3 mRNA CTD PMID:19162173 Plpp3 Rat progesterone increases expression ISO PLPP3 (Homo sapiens) 6480464 Progesterone results in increased expression of PLPP3 mRNA CTD PMID:20864642 Plpp3 Rat propiconazole decreases expression ISO Plpp3 (Mus musculus) 6480464 propiconazole results in decreased expression of PLPP3 mRNA CTD PMID:21278054 Plpp3 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of PLPP3 mRNA CTD PMID:19423681 Plpp3 Rat raloxifene affects expression ISO PLPP3 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of PLPP3 mRNA CTD PMID:14699072 Plpp3 Rat raloxifene multiple interactions ISO PLPP3 (Homo sapiens) 6480464 ESR1 protein affects the reaction [Raloxifene Hydrochloride results in increased expression of PLPP3 mRNA] CTD PMID:14699072 Plpp3 Rat Securinine decreases expression ISO PLPP3 (Homo sapiens) 6480464 securinine results in decreased expression of PLPP3 mRNA CTD PMID:32662633 Plpp3 Rat selenium atom decreases expression ISO PLPP3 (Homo sapiens) 6480464 Selenium results in decreased expression of PLPP3 mRNA CTD PMID:19244175 Plpp3 Rat serpentine asbestos affects expression ISO PLPP3 (Homo sapiens) 6480464 Asbestos and Serpentine affects the expression of PLPP3 mRNA CTD PMID:24160326 Plpp3 Rat silicon dioxide increases expression ISO PLPP3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of PLPP3 mRNA CTD PMID:25351596 Plpp3 Rat silicon dioxide increases expression ISO Plpp3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PLPP3 mRNA CTD PMID:29203145 Plpp3 Rat sodium arsenite increases expression ISO PLPP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PLPP3 mRNA CTD PMID:28595984 more ... Plpp3 Rat sodium arsenite multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLPP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLPP3 mRNA CTD PMID:39836092 Plpp3 Rat sodium arsenite increases expression ISO Plpp3 (Mus musculus) 6480464 sodium arsenite results in increased expression of PLPP3 protein CTD PMID:29044176 Plpp3 Rat sodium aurothiomalate decreases expression ISO PLPP3 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in decreased expression of PLPP3 mRNA CTD PMID:19192274 Plpp3 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of PLPP3 mRNA CTD PMID:22110744 Plpp3 Rat sodium dodecyl sulfate increases expression ISO PLPP3 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of PLPP3 mRNA CTD PMID:31734321 Plpp3 Rat sodium fluoride decreases expression ISO Plpp3 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PLPP3 protein CTD PMID:28918527 Plpp3 Rat succimer multiple interactions ISO Plpp3 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of PLPP3 mRNA CTD PMID:21641980 Plpp3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PPAP2B mRNA CTD PMID:30047161 Plpp3 Rat tamoxifen affects expression ISO Plpp3 (Mus musculus) 6480464 Tamoxifen affects the expression of PLPP3 mRNA CTD PMID:17555576 Plpp3 Rat testosterone enanthate affects expression ISO PLPP3 (Homo sapiens) 6480464 testosterone enanthate affects the expression of PLPP3 mRNA CTD PMID:17440010 Plpp3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PLPP3 mRNA CTD PMID:16239168 and PMID:31150632 Plpp3 Rat tetrachloromethane decreases expression ISO Plpp3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PLPP3 mRNA CTD PMID:27339419 and PMID:31919559 Plpp3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PLPP3 mRNA CTD PMID:23411599 and PMID:34492290 Plpp3 Rat titanium dioxide decreases methylation ISO Plpp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PPAP2B gene CTD PMID:35295148 Plpp3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLPP3 mRNA CTD PMID:25729387 Plpp3 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PLPP3 mRNA CTD PMID:25729387 Plpp3 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of PPAP2B mRNA CTD PMID:30047161 Plpp3 Rat triclosan increases expression ISO PLPP3 (Homo sapiens) 6480464 Triclosan results in increased expression of PPAP2B mRNA CTD PMID:30510588 Plpp3 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of PLPP3 mRNA CTD PMID:30589522 Plpp3 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PLPP3 protein CTD PMID:32519852 Plpp3 Rat troglitazone decreases expression ISO Plpp3 (Mus musculus) 6480464 troglitazone results in decreased expression of PLPP3 mRNA CTD PMID:28973697 Plpp3 Rat trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat tunicamycin decreases expression ISO PLPP3 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PLPP3 mRNA CTD PMID:22378314 Plpp3 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PLPP3 mRNA CTD PMID:24136188 Plpp3 Rat valproic acid affects expression ISO PLPP3 (Homo sapiens) 6480464 Valproic Acid affects the expression of PLPP3 mRNA CTD PMID:25979313 Plpp3 Rat valproic acid decreases expression ISO PLPP3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PLPP3 mRNA and Valproic Acid results in decreased expression of PPAP2B mRNA CTD PMID:24935251 more ... Plpp3 Rat valproic acid increases expression ISO PLPP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLPP3 mRNA CTD PMID:24935251 Plpp3 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PLPP3 promoter CTD PMID:22570695 Plpp3 Rat vincristine increases expression ISO PLPP3 (Homo sapiens) 6480464 Vincristine results in increased expression of PLPP3 mRNA CTD PMID:23649840 Plpp3 Rat vitamin E increases expression ISO PLPP3 (Homo sapiens) 6480464 Vitamin E results in increased expression of PLPP3 mRNA CTD PMID:19244175 Plpp3 Rat zinc atom multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PLPP3 mRNA CTD PMID:18593933 Plpp3 Rat zinc(0) multiple interactions ISO PLPP3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PLPP3 mRNA CTD PMID:18593933 Plpp3 Rat zoledronic acid increases expression ISO PLPP3 (Homo sapiens) 6480464 zoledronic acid results in increased expression of PLPP3 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 6alpha-methylprednisolone (ISO) acetamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucosamine (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) ATP (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-D-glucosamine (EXP) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) calyculin a (ISO) cannabidiol (ISO) carbon nanotube (ISO) chloroprene (EXP) choline (ISO) cisplatin (ISO) clofibric acid (EXP) cobalt dichloride (EXP) cocaine (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) diallyl disulfide (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) diuron (EXP) divanadium pentaoxide (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) gamma-hexachlorocyclohexane (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) graphite (EXP) hydrogen chloride (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoflavones (ISO) isotretinoin (ISO) L-methionine (ISO) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) metacetamol (ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel dichloride (EXP,ISO) nimesulide (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) potassium chromate (ISO) prednisolone (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propiconazole (EXP,ISO) raloxifene (ISO) Securinine (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) succimer (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triadimefon (EXP) triclosan (ISO) triphenyl phosphate (EXP) Triptolide (EXP) troglitazone (ISO) trovafloxacin (EXP) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
Bergmann glial cell differentiation (ISO) blood vessel development (ISO) cell adhesion (ISO) cell-cell adhesion (IBA,ISO) cell-cell adhesion mediated by integrin (ISO,ISS) ceramide metabolic process (ISO,ISS) gastrulation with mouth forming second (ISO) integrin-mediated signaling pathway (ISO,ISS) lipid metabolic process (IEA) phospholipid dephosphorylation (IBA,ISO,ISS) phospholipid metabolic process (IBA,IEA,ISO,ISS) positive regulation of endothelial cell migration (ISO) positive regulation of endothelial cell-matrix adhesion via fibronectin (ISO) positive regulation of homotypic cell-cell adhesion (ISO) positive regulation of intracellular signal transduction (ISO) positive regulation of peptidyl-tyrosine phosphorylation (ISO) positive regulation of transcription by RNA polymerase II (ISO) protein stabilization (ISO) regulation of sphingolipid mediated signaling pathway (ISO) regulation of Wnt signaling pathway (ISO) retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (ISO,ISS) signal transduction (IBA) sphingosine metabolic process (ISO,ISS)
Cellular Component
adherens junction (ISO) basolateral plasma membrane (IEA,ISO) endoplasmic reticulum (IEA) endoplasmic reticulum exit site (ISO,ISS) endoplasmic reticulum membrane (IDA,IEA) endoplasmic reticulum-Golgi intermediate compartment membrane (IEA,ISO,ISS) Golgi apparatus (IEA,ISO,ISS) Golgi membrane (IEA) membrane (IEA,ISO,ISS) membrane raft (IEA,ISO,ISS) plasma membrane (IBA,IEA,ISO) trans-Golgi network (ISO,ISS)
1.
The Dri 42 gene, whose expression is up-regulated during epithelial differentiation, encodes a novel endoplasmic reticulum resident transmembrane protein.
Barila D, etal., J Biol Chem 1996 Nov 22;271(47):29928-36.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Plpp3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 125,156,000 - 125,231,119 (+) NCBI GRCr8 mRatBN7.2 5 119,927,085 - 120,002,206 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 119,927,085 - 120,002,205 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 122,548,651 - 122,624,021 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 124,271,713 - 124,347,083 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 124,322,955 - 124,398,328 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 124,690,214 - 124,765,499 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 124,690,214 - 124,765,498 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 128,551,196 - 128,626,138 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 126,121,416 - 126,197,099 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 126,126,641 - 126,202,324 (+) NCBI Celera 5 118,477,102 - 118,551,973 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
PLPP3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 56,494,761 - 56,579,563 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 56,494,761 - 56,645,301 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 56,960,433 - 57,045,236 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 56,733,021 - 56,817,845 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 55,245,253 - 55,330,133 (-) NCBI Celera Cytogenetic Map 1 p32.2 NCBI HuRef 1 55,072,892 - 55,157,775 (-) NCBI HuRef CHM1_1 1 57,072,622 - 57,160,617 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 56,373,591 - 56,458,441 (-) NCBI T2T-CHM13v2.0
Plpp3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 105,014,544 - 105,089,964 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 105,014,544 - 105,089,961 (+) Ensembl GRCm39 Ensembl GRCm38 4 105,157,347 - 105,232,767 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 105,157,347 - 105,232,764 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 104,829,952 - 104,905,372 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 104,655,279 - 104,730,699 (+) NCBI MGSCv36 mm8 Celera 4 103,508,199 - 103,583,768 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 49.18 NCBI
Plpp3 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 3,081,334 - 3,197,413 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 3,122,420 - 3,197,359 (+) NCBI ChiLan1.0 ChiLan1.0
PLPP3 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 170,181,721 - 170,332,442 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 169,400,091 - 169,484,785 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 55,779,343 - 55,862,717 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 57,489,178 - 57,573,307 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 57,489,178 - 57,573,398 (-) Ensembl panpan1.1 panPan2
PLPP3 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 52,924,443 - 53,006,298 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 52,923,833 - 53,005,493 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 52,992,430 - 53,074,349 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 53,112,365 - 53,194,538 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 53,112,379 - 53,194,536 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 53,055,985 - 53,137,860 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 53,001,878 - 53,083,760 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 53,386,869 - 53,468,888 (+) NCBI UU_Cfam_GSD_1.0
Plpp3 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 70,341,999 - 70,423,866 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 4,992,322 - 5,074,313 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 4,992,333 - 5,074,295 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLPP3 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 155,800,678 - 155,894,912 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 155,800,838 - 155,894,919 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 143,642,088 - 143,734,081 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLPP3 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 76,382,041 - 76,466,497 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 76,382,079 - 76,477,847 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 40,825,335 - 40,909,946 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plpp3 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 739 Count of miRNA genes: 283 Interacting mature miRNAs: 381 Transcripts: ENSRNOT00000011237 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 7794739 Bp372 Blood pressure QTL 372 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 117913688 125222967 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1582230 Bw78 Body weight QTL 78 3.2 0.0016 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 119085612 128034027 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH129678
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 125,230,834 - 125,231,045 (+) Marker Load Pipeline mRatBN7.2 5 120,001,921 - 120,002,132 (+) MAPPER mRatBN7.2 Rnor_6.0 5 124,765,215 - 124,765,425 NCBI Rnor6.0 Rnor_5.0 5 128,625,854 - 128,626,064 UniSTS Rnor5.0 RGSC_v3.4 5 126,196,815 - 126,197,025 UniSTS RGSC3.4 Celera 5 118,551,689 - 118,551,899 UniSTS Cytogenetic Map 5 q34 UniSTS
BF410958
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 119,936,995 - 119,937,085 (+) MAPPER mRatBN7.2 Rnor_6.0 5 124,700,124 - 124,700,213 NCBI Rnor6.0 Rnor_5.0 5 128,561,106 - 128,561,195 UniSTS Rnor5.0 RGSC_v3.4 5 126,131,326 - 126,131,415 UniSTS RGSC3.4 Celera 5 118,487,012 - 118,487,101 UniSTS Cytogenetic Map 5 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011237 ⟹ ENSRNOP00000011237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 119,927,085 - 120,002,205 (+) Ensembl Rnor_6.0 Ensembl 5 124,690,214 - 124,765,498 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106902 ⟹ ENSRNOP00000095295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 119,927,085 - 119,995,656 (+) Ensembl
RefSeq Acc Id:
NM_138905 ⟹ NP_620260
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 125,156,000 - 125,231,119 (+) NCBI mRatBN7.2 5 119,927,085 - 120,002,206 (+) NCBI Rnor_6.0 5 124,690,214 - 124,765,499 (+) NCBI Rnor_5.0 5 128,551,196 - 128,626,138 (+) NCBI RGSC_v3.4 5 126,121,416 - 126,197,099 (+) RGD Celera 5 118,477,102 - 118,551,973 (+) RGD
Sequence:
CAGAAGGAGGAGGCAGAGTTGGAGTTGGGCAGACGCTGTGGAGAGCTAGCTGCAGGACGCTGCGGAGTTGCAGGGCTCCGCGCTGCTCCATTCATTAAGTAGCTGCGGAGGATCGTGGCCGGACGCCG ACGCTGCCCACTCGCAAACTTCAGCACGCAGACGCACGCCAGCCCGGCGCGTCCGGGACAGCACAGTTTTGCAAAAGTTCCTGCTCGGGATTTGGCTCTCTTCCCTTTGGACTAGCGAACAGTTTGGG GTTGAGAGGAAAGCAGAGGCGCTCAGGGGGAAACCTACCCGCGTCTGCAGTTGGAGCTACTCGGCCGGGCTGTACACTCGCCGCCGCGTCCCGAGCCCGCAGATCCGCTCCTGAGCAGCGGCGGCCCG CAGCGCCCCGGGAGGCTCCCCGCAGCCAGCGCCATGCAAAGCTACAAGTACGACAAGGCGATCGTCCCTGAGAGTAAGAACGGCGGTAGCCCGGCGCTCAACAACAACCCGAGGAAAGGCGGCAGCAA GCGGGTGCTGCTCATCTGCCTCGACCTCTTCTGCCTCTTCATGGCGGCTCTGCCCTTCCTCATCATCGAGACAAGCACCATTAAGCCTTATCGTCGAGGGTTTTACTGCAACGACGAGAGCATCAAGT ACCCCCTGAAAGTCAGCGAGACTATAAACGACGCCGTGCTCTGTGCGGTGGGGATCGTCATCGCCATCCTGGCGATCATCACGGGGGAATTCTACCGGATCTATTACCTCAAGGAGAAGTCCCGATCC ACCATTCAGAACCCTTATGTGGCCGCTCTCTATAAGCAAGTGGGATGCTTCCTTTTCGGCTGTGCCATCAGCCAGTCCTTCACAGACATCGCCAAAGTGTCCATTGGGCGCCTGAGGCCTCACTTCCT CAGCGTCTGTGACCCTGATTTCAGTCAGATCAATTGCTCCGAGGGCTACATTCAGAACTACAGGTGCCGAGGAGAAGACAGCAAAGTACAGGAGGCCAGGAAATCCTTCTTCTCGGGCCACGCCTCCT TCTCCATGTTCACAATGCTGTATCTGGTGCTTTATCTACAGGCCCGCTTCACCTGGCGTGGGGCCCGGCTCCTCCGCCCCCTCCTGCAGTTCACTTTGCTCATGATGGCCTTCTACACGGGATTGTCA CGTGTATCTGACTACAAACACCATCCTAGCGATGTCCTGGCAGGATTTGCCCAAGGAGCTCTGGTGGCCTGCTGCATAGTGTTCTTCGTGTCTGACCTCTTCAAGACTAAGACGACCCTCTCACTGCC TGCCCCCGCGATCAGGAGAGAGATCCTGTCTCCTGTAGACATCATGGACAGGAGCAATCACCACAACATGGTGTAGGTGCTGCGGCCTCCAGAGCACTTTCTCTGAAGCGACTGCTTGACAGCATGTC CCTGCTGCTCTCCAATCTCATCAGACAGTAGAATGTAGGGAAAAGCTTTTTGCCCGATGGATTTTGAAAACATTTAAAGAAAAAAAAAAAGCCTTACCTTGTGGCCTTCCAAAATAGGTTGTTTGCCT GTGTGGAGACAACAGTGCCGGAGTCCTGAGTGCTGGCTGCACAGCTGGCTAAGTGTTCATGTTCTAGTGAGCACGGGCTTGTCAGGAGCAAAACACTAGGATAATTGAGCAGAGGCTGTGGTCACCTT TTGTGACCCGAGAAATCCCAGGCCAGAATAGCGGGGGCGCTTATGTAGCATGCAAGGCCTGAACCAGCACCGAATCAGCCCCTCTGCCTGCCCCACTCTACTGTGACTTTGATTCAAGGAAGTTTTTG CGCTTTGAAATACCGGGAATGAACACACAGTTTTTCAGTCGAGGGATCAGATCCTGAATCCAAACCCCATGTCCTGAGGCCTCTGTCATCTCTCCATCCCCAGGCTAACAACCACAGTCCCCTCACTT TTAGAGATTAGGAGACCCTTTGTGGAAGAGTGAACTTCACAAATAGCACAAGTTCAGAAGACATGTAGGGTGTCTTCTCACACACCACACTGTGACGCACGCGGAACTGCCATTGCGGGGTCAATCAC CAGGCACTTGCACGTGTAGAAACCCGTAGACTTTGGTTACTGCTATATCCCCCTTGAGATCCTTGCTGGGTGCCTACCAGGATTTCATGTGAGGGCCAGGGATGCATAGGCATGGCCAACCTTTGGTG GATCAAAAGAGCCTCAGTAGAGAGACAGGGAGGGAGGGAGAGGGCAGAATGAAAAAAAAGTGAACCAATTCTTTTGGCTCCTTGGGTTTAGAGAGAGCCAGGGTAGCAGACAGTCTTATGCCCAAAAG GTACCCTTCCAGATAAGGGAGCCCCAAGGGTCTTCGCAGGAGTTGATCTTGCTGTGTAAAGCACTGTTGTCGCAGGGTTGACCCCTGGGACAGTTCTTGGTGGGTTCTGCTGGGCAGAACACATAGGT TAAATCTGTGTCGAGAGTTTTCCTCATACTCTATCCACAAGTGTCCTTCCAAGCAAGGTCCCACTCTAGCCAGTAGACAAGGTCCCTTCTACTGAACCTCCAAGGAAAAGAAGAAGGAGAAGAAAAAG TGCTTTTCAAATCTTTCAAAGGGCTACATGTAACCATATGGATCAACCACATGCATATCCTCCCAGACTCCGTCCTTTCATTTCAACATATAGCAAGCTATGATTTTATATATAAAATTATATAAATA ATGTATAAAACAGTAAAAGTTAACTATGTAAGATATTATTTCTGAAACAATGTTAGTCACACCCACTATGATTATAAACTGTGTCTTGACCTGTGTTATTTACTTTAGCTGCTTAAAGGAGCATTGAG TTTTTTTGGTTTGTTTTTTTTTTTTTTTTAATCTCAACTAAAGATATCATAGTTCTGTGGTAGCCATTGTTTTACAATGAAATAACTGCGACTAGAGGGAAAAAGAACTGTATAAAAACATTAAATTG TCAGTATTTTTGTAAGGTTCCGTTTTGTAAAGAGAATAATATTCAAACACTTCTGTGGCATACAAAGTGAAAAATGTGTATCTGAGAAACTAAACATGTATTAAATGTGCTTTTTAAAATAAAAGCTC ATAACATGAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_620260 ⟸ NM_138905
- UniProtKB:
P97544 (UniProtKB/Swiss-Prot), Q6IMX4 (UniProtKB/TrEMBL), A6JRU2 (UniProtKB/TrEMBL), F7FJE5 (UniProtKB/TrEMBL)
- Sequence:
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTIQNPYVAALY KQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSD VLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPVDIMDRSNHHNMV
hide sequence
Ensembl Acc Id:
ENSRNOP00000011237 ⟸ ENSRNOT00000011237
Ensembl Acc Id:
ENSRNOP00000095295 ⟸ ENSRNOT00000106902
RGD ID: 13693874
Promoter ID: EPDNEW_R4399
Type: multiple initiation site
Name: Plpp3_1
Description: phospholipid phosphatase 3
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 124,690,244 - 124,690,304 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-10-26
Plpp3
phospholipid phosphatase 3
Ppap2b
phosphatidic acid phosphatase type 2B
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Ppap2b
phosphatidic acid phosphatase type 2B
ER transmembrane protein Dri 42
Name updated
1299863
APPROVED
2004-09-10
Ppap2b
ER transmembrane protein Dri 42
Dri42
Symbol and Name updated
1299863
APPROVED
2002-08-07
Dri42
ER transmembrane protein Dri 42
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
resident in the endoplasmic reticulum
632577
gene_expression
expressed in intestine
632577
gene_regulation
increased during epithelial differentiation
632577