Symbol:
Cga
Name:
glycoprotein hormones, alpha polypeptide
RGD ID:
620436
Description:
Predicted to enable follicle-stimulating hormone activity. Predicted to be involved in several processes, including positive regulation of steroid biosynthetic process; regulation of signaling receptor activity; and thyroid hormone generation. Predicted to act upstream of or within several processes, including gonadotropin secretion; negative regulation of organ growth; and thyroid gland development. Predicted to be part of follicle-stimulating hormone complex. Predicted to be active in extracellular space. Orthologous to human CGA (glycoprotein hormones, alpha polypeptide); PARTICIPATES IN follicle-stimulating hormone signaling pathway; luteinizing hormone signaling pathway; autoimmune thyroiditis pathway; INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
anterior pituitary glycoprotein hormones common subunit alpha; follicle-stimulating hormone alpha chain; follitropin alpha chain; FSH-alpha; glycoprotein hormone alpha subunit; glycoprotein hormones alpha chain; glycoprotein hormones, alpha subunit; Gpa1; LSH-alpha; luteinizing hormone alpha chain; lutropin alpha chain; pituitary hormone; pituitary hormone alpha subunit; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain; TSH-alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CGA (glycoprotein hormones, alpha polypeptide) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cga (glycoprotein hormones, alpha subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cga (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CGA (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CGA (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cga (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CGA (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CGA (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cga (glycoprotein hormones, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cga (glycoprotein hormones, alpha subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CGA (glycoprotein hormones, alpha polypeptide)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cga (glycoprotein hormones, alpha polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cga
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 54,283,109 - 54,295,464 (+) NCBI GRCr8 mRatBN7.2 5 49,486,915 - 49,499,192 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 49,487,068 - 49,499,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 51,680,297 - 51,692,413 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 53,280,529 - 53,292,645 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 53,182,409 - 53,194,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 50,362,491 - 50,393,368 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 50,381,244 - 50,393,367 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 54,950,198 - 54,962,319 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 51,538,259 - 51,550,324 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 51,538,437 - 51,550,503 (+) NCBI Celera 5 48,231,474 - 48,243,595 (+) NCBI Celera RH 3.4 Map 5 269.7 RGD Cytogenetic Map 5 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cga Rat (S)-nicotine increases expression ISO CGA (Homo sapiens) 6480464 Nicotine results in increased expression of CGA mRNA CTD PMID:23825647 Cga Rat 17alpha-ethynylestradiol increases expression ISO Cga (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CGA mRNA CTD PMID:17555576 Cga Rat 17alpha-ethynylestradiol multiple interactions ISO Cga (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CGA mRNA CTD PMID:17942748 Cga Rat 17beta-estradiol multiple interactions EXP 6480464 Estradiol inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of CGA mRNA] CTD PMID:21187122 Cga Rat 17beta-estradiol multiple interactions ISO Cga (Mus musculus) 6480464 ESR2 gene mutant form inhibits the reaction [CGA protein results in increased abundance of Estradiol] CTD PMID:20378682 Cga Rat 17beta-estradiol increases abundance ISO CGA (Homo sapiens) 6480464 CGA protein results in increased abundance of Estradiol CTD PMID:19501113 and PMID:20378682 Cga Rat 17beta-estradiol multiple interactions ISO CGA (Homo sapiens) 6480464 [CGA protein co-treated with FSHB protein] affects the abundance of Estradiol more ... CTD PMID:19501113 more ... Cga Rat 17beta-estradiol increases expression ISO CGA (Homo sapiens) 6480464 Estradiol results in increased expression of CGA protein CTD PMID:19580841 Cga Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CGA mRNA CTD PMID:16522720 more ... Cga Rat 17beta-estradiol 3-benzoate decreases expression ISO Cga (Mus musculus) 6480464 estradiol 3-benzoate results in decreased expression of CGA mRNA CTD PMID:15223135 Cga Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Cga Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 CGA protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of ESR1 protein] more ... CTD PMID:12128104 and PMID:21187122 Cga Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cga (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CGA mRNA CTD PMID:24793433 Cga Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CGA mRNA CTD PMID:22493514 Cga Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CGA mRNA CTD PMID:21187122 Cga Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cga (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CGA mRNA CTD PMID:17942748 Cga Rat 2-hydroxypropanoic acid decreases expression ISO CGA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CGA mRNA CTD PMID:30851411 Cga Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 [Flufenamic Acid results in decreased abundance of Cyclic AMP] which results in decreased expression of CGA mRNA CTD PMID:8404651 Cga Rat 3',5'-cyclic AMP affects secretion ISO CGA (Homo sapiens) 6480464 CGA protein affects the secretion of Cyclic AMP CTD PMID:23071612 Cga Rat 3',5'-cyclic AMP increases abundance ISO CGA (Homo sapiens) 6480464 CGA protein results in increased abundance of Cyclic AMP CTD PMID:20378682 more ... Cga Rat 3',5'-cyclic AMP multiple interactions ISO CGA (Homo sapiens) 6480464 [CGA protein affects the secretion of Cyclic AMP] which results in increased secretion of Progesterone more ... CTD PMID:20378682 more ... Cga Rat 3',5'-cyclic AMP multiple interactions ISO Cga (Mus musculus) 6480464 [ESR2 gene mutant form results in decreased expression of LHCGR protein] inhibits the reaction [CGA protein results in increased abundance of Cyclic AMP] more ... CTD PMID:20378682 Cga Rat 3,3',5-triiodo-L-thyronine multiple interactions EXP 6480464 Phenelzine inhibits the reaction [Triiodothyronine results in decreased expression of CGA mRNA] and Triiodothyronine inhibits the reaction [Phenelzine results in increased expression of CGA mRNA] CTD PMID:20148560 Cga Rat 3,3',5-triiodo-L-thyronine decreases expression EXP 6480464 Triiodothyronine results in decreased expression of CGA mRNA CTD PMID:20148560 Cga Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO Cga (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [cypermethrin results in increased expression of CGA mRNA] CTD PMID:29149324 Cga Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions EXP 6480464 bisindolylmaleimide I inhibits the reaction [[CGA protein co-treated with Atrazine] results in increased expression of STAR mRNA] CTD PMID:27554787 Cga Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CGA (Homo sapiens) 6480464 [CGA protein co-treated with 1-Methyl-3-isobutylxanthine] results in increased abundance of Cyclic AMP CTD PMID:23071612 Cga Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CGA mRNA CTD PMID:25825206 Cga Rat 8-Br-cAMP increases expression EXP 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CGA mRNA CTD PMID:21467749 and PMID:8404651 Cga Rat 8-Br-cAMP increases expression ISO CGA (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CGA mRNA CTD PMID:22079614 Cga Rat acetaldehyde increases abundance ISO CGA (Homo sapiens) 6480464 CGA protein results in increased abundance of Acetaldehyde CTD PMID:22285649 Cga Rat acetaldehyde multiple interactions ISO Cga (Mus musculus) 6480464 [CGA protein results in increased abundance of Acetaldehyde] which results in decreased expression of ALDH1A1 mRNA more ... CTD PMID:22285649 Cga Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of CGA mRNA CTD PMID:3427795 Cga Rat amphotericin B increases expression ISO CGA (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of CGA mRNA CTD PMID:28534445 Cga Rat anandamide decreases expression ISO CGA (Homo sapiens) 6480464 anandamide results in decreased expression of CGA mRNA CTD PMID:30610963 Cga Rat androst-4-ene-3,17-dione multiple interactions EXP 6480464 LEP protein inhibits the reaction [CGA protein results in increased secretion of Androstenedione] and Sodium Glutamate inhibits the reaction [CGA protein results in increased secretion of Androstenedione] CTD PMID:14657608 Cga Rat androst-4-ene-3,17-dione increases secretion EXP 6480464 CGA protein results in increased secretion of Androstenedione CTD PMID:14657608 Cga Rat arsenous acid increases expression ISO CGA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CGA mRNA CTD PMID:20458559 Cga Rat atrazine increases expression ISO CGA (Homo sapiens) 6480464 Atrazine results in increased expression of CGA mRNA CTD PMID:18461179 Cga Rat atrazine multiple interactions ISO CGA (Homo sapiens) 6480464 Atrazine inhibits the reaction [[FSHB protein co-treated with CGA protein] results in increased expression of AREG mRNA] and Atrazine inhibits the reaction [[FSHB protein co-treated with CGA protein] results in increased expression of EREG mRNA] CTD PMID:28859905 Cga Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CGA gene CTD PMID:28931070 Cga Rat atrazine multiple interactions EXP 6480464 [Atrazine inhibits the reaction [FSHB protein results in increased expression of LHCGR mRNA]] inhibits the reaction [CGA protein results in increased expression of AREG mRNA] more ... CTD PMID:23583632 and PMID:27554787 Cga Rat benzo[a]pyrene multiple interactions ISO CGA (Homo sapiens) 6480464 Benzo(a)pyrene inhibits the reaction [CGA results in increased abundance of Testosterone] CTD PMID:21737371 Cga Rat benzo[a]pyrene affects methylation ISO CGA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CGA promoter CTD PMID:27901495 Cga Rat benzo[a]pyrene increases expression ISO CGA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CGA mRNA CTD PMID:24361490 Cga Rat bifenthrin multiple interactions EXP 6480464 bifenthrin analog inhibits the reaction [CGA protein results in increased abundance of Progesterone] more ... CTD PMID:21251947 and PMID:21871944 Cga Rat bifenthrin multiple interactions ISO CGA (Homo sapiens) 6480464 fulvestrant inhibits the reaction [bifenthrin results in increased secretion of CGA protein] CTD PMID:24938463 Cga Rat bifenthrin increases secretion ISO CGA (Homo sapiens) 6480464 bifenthrin results in increased secretion of CGA protein CTD PMID:24938463 Cga Rat bis(2-ethylhexyl) phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:25016925 and PMID:37552060 Cga Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CGA mRNA and Diethylhexyl Phthalate results in increased expression of CGA protein CTD PMID:36714560 Cga Rat bis(2-ethylhexyl) phthalate increases expression ISO Cga (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CGA mRNA CTD PMID:37812459 Cga Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat bis(2-ethylhexyl) phthalate increases expression ISO CGA (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of CGA mRNA CTD PMID:31163220 Cga Rat bisphenol A increases expression ISO CGA (Homo sapiens) 6480464 bisphenol A results in increased expression of CGA mRNA CTD PMID:25784278 Cga Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CGA mRNA CTD PMID:34973380 Cga Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CGA mRNA CTD PMID:25181051 Cga Rat butanal increases expression ISO CGA (Homo sapiens) 6480464 butyraldehyde results in increased expression of CGA mRNA CTD PMID:26079696 Cga Rat Butylbenzyl phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:25016925 and PMID:37552060 Cga Rat Butylbenzyl phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat butyric acid decreases stability ISO CGA (Homo sapiens) 6480464 Butyric Acid results in decreased stability of CGA mRNA CTD PMID:1693837 Cga Rat butyric acid increases expression ISO CGA (Homo sapiens) 6480464 Butyric Acid results in increased expression of CGA mRNA and Butyric Acid results in increased expression of CGA protein CTD PMID:1693836 and PMID:1693837 Cga Rat butyric acid multiple interactions ISO CGA (Homo sapiens) 6480464 [Theophylline co-treated with Butyric Acid] results in increased expression of CGA mRNA more ... CTD PMID:1693836 and PMID:1693837 Cga Rat cadmium dichloride decreases activity ISO CGA (Homo sapiens) 6480464 Cadmium Chloride results in decreased activity of CGA protein CTD PMID:18040592 Cga Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of CGA promoter CTD PMID:22457795 Cga Rat calcitriol decreases expression ISO CGA (Homo sapiens) 6480464 Calcitriol results in decreased expression of CGA mRNA CTD PMID:16002434 Cga Rat colforsin daropate hydrochloride multiple interactions ISO CGA (Homo sapiens) 6480464 Colforsin promotes the reaction [CGA protein results in increased abundance of Cyclic AMP] more ... CTD PMID:20378682 and PMID:33144174 Cga Rat colforsin daropate hydrochloride increases expression ISO CGA (Homo sapiens) 6480464 Colforsin results in increased expression of CGA protein CTD PMID:33144174 Cga Rat colforsin daropate hydrochloride multiple interactions ISO Cga (Mus musculus) 6480464 Colforsin inhibits the reaction [ESR2 gene mutant form inhibits the reaction [CGA protein results in increased abundance of Cyclic AMP]] CTD PMID:20378682 Cga Rat colforsin daropate hydrochloride increases secretion ISO CGA (Homo sapiens) 6480464 Colforsin results in increased secretion of CGA protein CTD PMID:16503475 Cga Rat colforsin daropate hydrochloride increases expression EXP 6480464 Colforsin results in increased expression of CGA mRNA CTD PMID:8404651 Cga Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of CGA mRNA CTD PMID:26033743 Cga Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of CGA mRNA CTD PMID:26033743 Cga Rat cyanamide multiple interactions ISO Cga (Mus musculus) 6480464 Cyanamide inhibits the reaction [CGA protein results in increased expression of BMP7 mRNA] more ... CTD PMID:22285649 Cga Rat cyclosporin A decreases expression ISO CGA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CGA mRNA CTD PMID:33631201 Cga Rat cypermethrin increases expression ISO Cga (Mus musculus) 6480464 cypermethrin results in increased expression of CGA mRNA CTD PMID:28731686 more ... Cga Rat cypermethrin multiple interactions ISO Cga (Mus musculus) 6480464 1 more ... CTD PMID:28731686 and PMID:29149324 Cga Rat DDE multiple interactions ISO CGA (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene affects the reaction [CGA protein results in increased expression of AR mRNA] CTD PMID:27391359 Cga Rat DDT multiple interactions ISO CGA (Homo sapiens) 6480464 DDT inhibits the reaction [CGA protein results in increased abundance of Cyclic AMP] more ... CTD PMID:26895433 and PMID:33638691 Cga Rat DDT increases expression ISO Cga (Mus musculus) 6480464 DDT results in increased expression of CGA mRNA CTD PMID:24814263 Cga Rat DDT multiple interactions ISO Cga (Mus musculus) 6480464 2-(2-chloro-4-iodophenylamino)-N-cyclopropylmethoxy-3 and 4-difluorobenzamide inhibits the reaction [DDT results in increased expression of CGA mRNA] CTD PMID:24814263 Cga Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of CGA mRNA CTD PMID:23640034 Cga Rat decabromodiphenyl ether multiple interactions ISO CGA (Homo sapiens) 6480464 decabromobiphenyl ether inhibits the reaction [CGA protein results in increased secretion of Progesterone] CTD PMID:31132478 Cga Rat diarsenic trioxide increases expression ISO CGA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CGA mRNA CTD PMID:20458559 Cga Rat dibutyl phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:25016925 and PMID:37552060 Cga Rat dibutyl phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat diethyl phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat diethyl phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:37552060 Cga Rat diethylstilbestrol affects expression EXP 6480464 Diethylstilbestrol affects the expression of CGA mRNA CTD PMID:36653537 Cga Rat diisobutyl phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat diisobutyl phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:37552060 Cga Rat diisononyl phthalate multiple interactions ISO Cga (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein results in increased expression of ADAMTS1 mRNA] more ... CTD PMID:33316053 Cga Rat diisononyl phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the reaction [CGA protein affects the expression of ADAMTS1 mRNA] more ... CTD PMID:37552060 Cga Rat diisononyl phthalate increases expression ISO Cga (Mus musculus) 6480464 diisononyl phthalate results in increased expression of CGA mRNA CTD PMID:37812459 Cga Rat dorsomorphin multiple interactions ISO CGA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cga Rat equol decreases expression EXP 6480464 Equol results in decreased expression of CGA mRNA CTD PMID:23220561 Cga Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions EXP 6480464 [Egtazic Acid co-treated with 1 more ... CTD PMID:27554787 Cga Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO Cga (Mus musculus) 6480464 Egtazic Acid inhibits the reaction [cypermethrin results in increased expression of CGA mRNA] CTD PMID:28731686 Cga Rat ethylparaben decreases expression ISO CGA (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of CGA mRNA CTD PMID:37690743 Cga Rat flufenamic acid multiple interactions EXP 6480464 [Flufenamic Acid results in decreased abundance of Cyclic AMP] which results in decreased expression of CGA mRNA CTD PMID:8404651 Cga Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CGA mRNA CTD PMID:23220561 Cga Rat fulvestrant multiple interactions ISO CGA (Homo sapiens) 6480464 fulvestrant inhibits the reaction [bifenthrin results in increased secretion of CGA protein] more ... CTD PMID:19580841 and PMID:24938463 Cga Rat iodoacetic acid decreases expression ISO Cga (Mus musculus) 6480464 Iodoacetic Acid results in decreased expression of CGA mRNA CTD PMID:34453833 Cga Rat iron dichloride increases expression ISO CGA (Homo sapiens) 6480464 ferrous chloride results in increased expression of CGA mRNA CTD PMID:35984750 Cga Rat ketoconazole decreases expression ISO Cga (Mus musculus) 6480464 Ketoconazole results in decreased expression of CGA mRNA CTD PMID:25808816 Cga Rat lead diacetate decreases activity ISO Cga (Mus musculus) 6480464 lead acetate results in decreased activity of CGA protein CTD PMID:11213355 Cga Rat lead diacetate multiple interactions ISO Cga (Mus musculus) 6480464 lead acetate inhibits the reaction [CGA protein results in increased abundance of Progesterone] CTD PMID:11213355 and PMID:12647776 Cga Rat methotrexate affects response to substance ISO CGA (Homo sapiens) 6480464 CGA protein affects the susceptibility to Methotrexate CTD PMID:16217747 Cga Rat methoxychlor increases expression ISO Cga (Mus musculus) 6480464 Methoxychlor results in increased expression of CGA mRNA CTD PMID:24814263 Cga Rat methoxychlor multiple interactions ISO CGA (Homo sapiens) 6480464 Methoxychlor affects the reaction [CGA protein results in increased expression of AR mRNA] CTD PMID:27391359 Cga Rat methoxychlor multiple interactions ISO Cga (Mus musculus) 6480464 2-(2-chloro-4-iodophenylamino)-N-cyclopropylmethoxy-3 and 4-difluorobenzamide inhibits the reaction [Methoxychlor results in increased expression of CGA mRNA] CTD PMID:24814263 Cga Rat mono(2-ethylhexyl) phthalate multiple interactions ISO CGA (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate inhibits the reaction [CGA protein results in increased abundance of Estradiol] CTD PMID:19501113 Cga Rat mono(2-ethylhexyl) phthalate affects expression ISO CGA (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate affects the expression of CGA mRNA CTD PMID:28381288 Cga Rat mono(2-ethylhexyl) phthalate increases expression ISO CGA (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of CGA mRNA CTD PMID:29089286 Cga Rat mono(2-ethylhexyl) phthalate increases secretion ISO CGA (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased secretion of CGA protein CTD PMID:29089286 Cga Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Cga (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate inhibits the reaction [CGA protein results in increased abundance of Progesterone] CTD PMID:27181934 Cga Rat monobenzyl phthalate increases expression ISO CGA (Homo sapiens) 6480464 mono-benzyl phthalate results in increased expression of CGA mRNA CTD PMID:29089286 Cga Rat monobenzyl phthalate affects expression ISO CGA (Homo sapiens) 6480464 mono-benzyl phthalate affects the expression of CGA mRNA CTD PMID:28381288 Cga Rat monobenzyl phthalate increases secretion ISO CGA (Homo sapiens) 6480464 mono-benzyl phthalate results in increased secretion of CGA protein CTD PMID:29089286 Cga Rat Monobutylphthalate increases expression ISO CGA (Homo sapiens) 6480464 monobutyl phthalate results in increased expression of CGA mRNA CTD PMID:29089286 Cga Rat Monobutylphthalate affects expression ISO CGA (Homo sapiens) 6480464 monobutyl phthalate affects the expression of CGA mRNA CTD PMID:28381288 Cga Rat monosodium L-glutamate multiple interactions EXP 6480464 Sodium Glutamate inhibits the reaction [CGA protein results in increased secretion of 7-hydroxyprogesterone] and Sodium Glutamate inhibits the reaction [CGA protein results in increased secretion of Androstenedione] CTD PMID:14657608 Cga Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO CGA (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [CGA protein results in increased cleavage of SREBF1 protein] and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [CGA protein results in increased cleavage of SREBF2 protein] CTD PMID:26125464 Cga Rat nickel sulfate increases expression ISO CGA (Homo sapiens) 6480464 nickel sulfate results in increased expression of CGA mRNA CTD PMID:18651567 Cga Rat nickel sulfate multiple interactions EXP 6480464 [CGA protein co-treated with nickel sulfate] results in decreased expression of CYP11A1 mRNA more ... CTD PMID:29567110 Cga Rat nicotine increases expression ISO CGA (Homo sapiens) 6480464 Nicotine results in increased expression of CGA mRNA CTD PMID:23825647 Cga Rat nimodipine multiple interactions ISO Cga (Mus musculus) 6480464 Nimodipine inhibits the reaction [cypermethrin results in increased expression of CGA mRNA] CTD PMID:28731686 Cga Rat Nonylphenol multiple interactions EXP 6480464 nonylphenol affects the reaction [CGA protein results in increased expression of CYP11A1 protein] more ... CTD PMID:19883722 Cga Rat Octicizer decreases expression ISO CGA (Homo sapiens) 6480464 2-ethylhexyldiphenylphosphate results in decreased expression of CGA protein CTD PMID:35503735 Cga Rat octreotide decreases secretion ISO CGA (Homo sapiens) 6480464 Octreotide results in decreased secretion of CGA protein CTD PMID:1518435 Cga Rat pentanal increases expression ISO CGA (Homo sapiens) 6480464 pentanal results in increased expression of CGA mRNA CTD PMID:26079696 Cga Rat perfluorobutanesulfonic acid multiple interactions ISO CGA (Homo sapiens) 6480464 perfluorobutanesulfonic acid inhibits the reaction [Colforsin results in increased expression of CGA protein] CTD PMID:33144174 Cga Rat perfluorooctane-1-sulfonic acid decreases expression ISO CGA (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of CGA mRNA CTD PMID:32790152 Cga Rat perfluorooctane-1-sulfonic acid multiple interactions ISO CGA (Homo sapiens) 6480464 perfluorooctane sulfonic acid inhibits the reaction [Colforsin results in increased expression of CGA protein] CTD PMID:33144174 Cga Rat perfluorooctanoic acid decreases expression ISO CGA (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of CGA mRNA CTD PMID:32790152 Cga Rat Phenelzine multiple interactions EXP 6480464 Phenelzine inhibits the reaction [Triiodothyronine results in decreased expression of CGA mRNA] and Triiodothyronine inhibits the reaction [Phenelzine results in increased expression of CGA mRNA] CTD PMID:20148560 Cga Rat Phenelzine increases expression EXP 6480464 Phenelzine results in increased expression of CGA mRNA CTD PMID:20148560 Cga Rat phenylmercury acetate increases expression ISO CGA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CGA mRNA CTD PMID:26272509 Cga Rat phenylmercury acetate multiple interactions ISO CGA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CGA mRNA CTD PMID:27188386 Cga Rat phorbol 13-acetate 12-myristate increases expression EXP 6480464 Tetradecanoylphorbol Acetate results in increased expression of CGA mRNA CTD PMID:21467749 Cga Rat progesterone multiple interactions EXP 6480464 [[3 more ... CTD PMID:18401014 more ... Cga Rat progesterone increases abundance ISO Cga (Mus musculus) 6480464 CGA protein results in increased abundance of Progesterone CTD PMID:11213355 more ... Cga Rat progesterone increases secretion ISO CGA (Homo sapiens) 6480464 CGA protein results in increased secretion of Progesterone CTD PMID:19228890 more ... Cga Rat progesterone increases secretion EXP 6480464 CGA protein results in increased secretion of Progesterone CTD PMID:18401014 Cga Rat progesterone increases abundance EXP 6480464 CGA protein results in increased abundance of Progesterone CTD PMID:21458522 and PMID:21871944 Cga Rat progesterone multiple interactions ISO CGA (Homo sapiens) 6480464 [3 more ... CTD PMID:18401014 more ... Cga Rat progesterone multiple interactions ISO Cga (Mus musculus) 6480464 lead acetate inhibits the reaction [CGA protein results in increased abundance of Progesterone] and mono-(2-ethylhexyl)phthalate inhibits the reaction [CGA protein results in increased abundance of Progesterone] CTD PMID:11213355 more ... Cga Rat propanal increases expression ISO CGA (Homo sapiens) 6480464 propionaldehyde results in increased expression of CGA mRNA CTD PMID:26079696 Cga Rat prostaglandin E2 multiple interactions EXP 6480464 bifenthrin analog inhibits the reaction [CGA protein results in increased secretion of Dinoprostone] and bifenthrin inhibits the reaction [CGA protein results in increased secretion of Dinoprostone] CTD PMID:21251947 and PMID:21871944 Cga Rat prostaglandin E2 increases secretion ISO CGA (Homo sapiens) 6480464 CGA protein results in increased secretion of Dinoprostone CTD PMID:25016925 Cga Rat prostaglandin E2 multiple interactions ISO CGA (Homo sapiens) 6480464 butylbenzyl phthalate inhibits the reaction [CGA protein results in increased secretion of Dinoprostone] more ... CTD PMID:25016925 Cga Rat prostaglandin E2 increases secretion EXP 6480464 CGA protein results in increased secretion of Dinoprostone CTD PMID:21251947 Cga Rat rac-lactic acid decreases expression ISO CGA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CGA mRNA CTD PMID:30851411 Cga Rat resveratrol multiple interactions EXP 6480464 [[resveratrol analog co-treated with CGA protein] results in decreased expression of CYP17A1 protein] which results in increased secretion of Progesterone more ... CTD PMID:19603415 Cga Rat resveratrol multiple interactions ISO CGA (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CGA mRNA more ... CTD PMID:19603415 and PMID:23557933 Cga Rat SB 431542 multiple interactions ISO CGA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cga Rat silicon dioxide increases expression ISO CGA (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CGA mRNA CTD PMID:23806026 Cga Rat silver atom decreases expression ISO CGA (Homo sapiens) 6480464 Silver results in decreased expression of CGA mRNA CTD PMID:28959546 Cga Rat silver(0) decreases expression ISO CGA (Homo sapiens) 6480464 Silver results in decreased expression of CGA mRNA CTD PMID:28959546 Cga Rat sodium arsenite multiple interactions EXP 6480464 CGA protein inhibits the reaction [sodium arsenite results in decreased expression of SORD protein] CTD PMID:16483355 Cga Rat sodium arsenite decreases expression ISO CGA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CGA mRNA CTD PMID:29301061 Cga Rat sodium arsenite decreases response to substance EXP 6480464 CGA protein results in decreased susceptibility to sodium arsenite CTD PMID:20146381 Cga Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of CGA mRNA CTD PMID:27257137 Cga Rat sodium perchlorate increases expression EXP 6480464 sodium perchlorate results in increased expression of CGA mRNA and sodium perchlorate results in increased expression of CGA protein CTD PMID:29139221 Cga Rat sophoraflavanone B decreases expression EXP 6480464 8-prenylnaringenin results in decreased expression of CGA mRNA CTD PMID:16522720 Cga Rat T-2 toxin multiple interactions ISO Cga (Mus musculus) 6480464 [T-2 Toxin co-treated with CGA protein] results in decreased activity of CYP11A1 protein more ... CTD PMID:25962641 Cga Rat T-2 toxin multiple interactions ISO CGA (Homo sapiens) 6480464 T-2 Toxin inhibits the reaction [[CGA protein co-treated with FSHB protein] results in increased expression of AREG mRNA] more ... CTD PMID:30951242 Cga Rat tamoxifen decreases expression ISO Cga (Mus musculus) 6480464 Tamoxifen results in decreased expression of CGA mRNA CTD PMID:25123088 Cga Rat taurine multiple interactions EXP 6480464 Taurine affects the reaction [CGA protein results in increased secretion of Testosterone] CTD PMID:19921479 Cga Rat taurine increases expression ISO CGA (Homo sapiens) 6480464 Taurine results in increased expression of CGA mRNA CTD PMID:16579726 Cga Rat tebuconazole decreases expression ISO CGA (Homo sapiens) 6480464 tebuconazole results in decreased expression of CGA mRNA CTD PMID:26852204 Cga Rat testosterone multiple interactions EXP 6480464 CGA protein promotes the reaction [CRH protein results in increased secretion of Testosterone] more ... CTD PMID:19883722 more ... Cga Rat testosterone increases secretion ISO Cga (Mus musculus) 6480464 CGA protein results in increased secretion of Testosterone CTD PMID:35259346 Cga Rat testosterone increases secretion ISO CGA (Homo sapiens) 6480464 CGA protein results in increased secretion of Testosterone CTD PMID:19228890 more ... Cga Rat testosterone increases abundance EXP 6480464 CGA protein results in increased abundance of Testosterone CTD PMID:21458522 Cga Rat testosterone increases secretion EXP 6480464 CGA protein results in increased secretion of Testosterone CTD PMID:19883722 and PMID:19921479 Cga Rat testosterone multiple interactions ISO CGA (Homo sapiens) 6480464 2-hydroxy-3 more ... CTD PMID:19228890 more ... Cga Rat testosterone increases abundance ISO CGA (Homo sapiens) 6480464 CGA results in increased abundance of Testosterone CTD PMID:21737371 Cga Rat testosterone enanthate decreases expression EXP 6480464 testosterone enanthate results in decreased expression of CGA mRNA CTD PMID:25603467 Cga Rat thapsigargin increases expression ISO CGA (Homo sapiens) 6480464 Thapsigargin results in increased expression of CGA mRNA CTD PMID:21694771 and PMID:29453283 Cga Rat theophylline multiple interactions ISO CGA (Homo sapiens) 6480464 [Theophylline co-treated with Butyric Acid] results in increased expression of CGA mRNA more ... CTD PMID:1693836 and PMID:1693837 Cga Rat theophylline increases stability ISO CGA (Homo sapiens) 6480464 Theophylline results in increased stability of CGA mRNA CTD PMID:1693837 Cga Rat theophylline increases expression ISO CGA (Homo sapiens) 6480464 Theophylline results in increased expression of CGA protein CTD PMID:1693837 Cga Rat thimerosal increases expression ISO Cga (Mus musculus) 6480464 Thimerosal results in increased expression of CGA mRNA CTD PMID:24675092 Cga Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CGA mRNA CTD PMID:33387578 Cga Rat trichostatin A increases expression ISO CGA (Homo sapiens) 6480464 trichostatin A results in increased expression of CGA mRNA CTD PMID:24935251 Cga Rat valproic acid affects expression ISO Cga (Mus musculus) 6480464 Valproic Acid affects the expression of CGA mRNA CTD PMID:17292431 Cga Rat valproic acid increases expression ISO CGA (Homo sapiens) 6480464 Valproic Acid results in increased expression of CGA mRNA CTD PMID:23179753 more ... Cga Rat valproic acid multiple interactions ISO CGA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CGA mRNA CTD PMID:27188386 Cga Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CGA mRNA CTD PMID:17980475 Cga Rat zearalenone multiple interactions ISO Cga (Mus musculus) 6480464 [Zearalenone co-treated with CGA protein] results in decreased expression of ATP1A1 protein more ... CTD PMID:25058043 Cga Rat zearalenone multiple interactions ISO CGA (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Zearalenone results in increased expression of CGA protein] CTD PMID:19580841 Cga Rat zearalenone increases expression ISO CGA (Homo sapiens) 6480464 Zearalenone results in increased expression of CGA protein CTD PMID:19580841
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic AMP (EXP,ISO) 3,3',5-triiodo-L-thyronine (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (EXP,ISO) acetaldehyde (ISO) amiodarone (EXP) amphotericin B (ISO) anandamide (ISO) androst-4-ene-3,17-dione (EXP) arsenous acid (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) bifenthrin (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) butanal (ISO) Butylbenzyl phthalate (ISO) butyric acid (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) colforsin daropate hydrochloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) cyanamide (ISO) cyclosporin A (ISO) cypermethrin (ISO) DDE (ISO) DDT (ISO) decabromodiphenyl ether (EXP,ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) equol (EXP) ethylene glycol bis(2-aminoethyl)tetraacetic acid (EXP,ISO) ethylparaben (ISO) flufenamic acid (EXP) flutamide (EXP) fulvestrant (ISO) iodoacetic acid (ISO) iron dichloride (ISO) ketoconazole (ISO) lead diacetate (ISO) methotrexate (ISO) methoxychlor (ISO) mono(2-ethylhexyl) phthalate (ISO) monobenzyl phthalate (ISO) Monobutylphthalate (ISO) monosodium L-glutamate (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) nickel sulfate (EXP,ISO) nicotine (ISO) nimodipine (ISO) Nonylphenol (EXP) Octicizer (ISO) octreotide (ISO) pentanal (ISO) perfluorobutanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) Phenelzine (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (EXP) progesterone (EXP,ISO) propanal (ISO) prostaglandin E2 (EXP,ISO) rac-lactic acid (ISO) resveratrol (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sodium fluoride (EXP) sodium perchlorate (EXP) sophoraflavanone B (EXP) T-2 toxin (ISO) tamoxifen (ISO) taurine (EXP,ISO) tebuconazole (ISO) testosterone (EXP,ISO) testosterone enanthate (EXP) thapsigargin (ISO) theophylline (ISO) thimerosal (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) vinclozolin (EXP) zearalenone (ISO)
1.
Fetal but not adult Leydig cells are susceptible to adenoma formation in response to persistently high hCG level: a study on hCG overexpressing transgenic mice.
Ahtiainen P, etal., Oncogene. 2005 Nov 10;24(49):7301-9.
2.
Human chorionic gonadotropin and free subunits' serum levels in patients with partial and complete hydatidiform moles.
Berkowitz R, etal., Obstet Gynecol. 1989 Aug;74(2):212-6.
3.
CGA gene (coding for the alpha subunit of glycoprotein hormones) overexpression in ER alpha-positive prostate tumors.
Bieche I, etal., Eur Urol. 2002 Mar;41(3):335-41.
4.
The CGA gene as new predictor of the response to endocrine therapy in ER alpha-positive postmenopausal breast cancer patients.
Bieche I, etal., Oncogene. 2001 Oct 18;20(47):6955-9.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
alpha Subunit of rat pituitary glycoprotein hormones. Primary structure of the precursor determined from the nucleotide sequence of cloned cDNAs.
Godine JE, etal., J Biol Chem 1982 Jul 25;257(14):8368-71.
7.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Distribution and characterization of alpha hCG in the serum and tumor cytosol of patients with breast cancer.
Shindelman JE, etal., Int J Cancer. 1980 May 15;25(5):599-604.
Cga Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 54,283,109 - 54,295,464 (+) NCBI GRCr8 mRatBN7.2 5 49,486,915 - 49,499,192 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 49,487,068 - 49,499,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 51,680,297 - 51,692,413 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 53,280,529 - 53,292,645 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 53,182,409 - 53,194,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 50,362,491 - 50,393,368 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 50,381,244 - 50,393,367 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 54,950,198 - 54,962,319 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 51,538,259 - 51,550,324 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 51,538,437 - 51,550,503 (+) NCBI Celera 5 48,231,474 - 48,243,595 (+) NCBI Celera RH 3.4 Map 5 269.7 RGD Cytogenetic Map 5 q21 NCBI
CGA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 87,085,498 - 87,095,106 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 87,085,498 - 87,095,106 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 87,795,216 - 87,804,824 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 87,851,941 - 87,861,543 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 87,851,940 - 87,861,543 NCBI Celera 6 88,213,978 - 88,223,577 (-) NCBI Celera Cytogenetic Map 6 q14.3 NCBI HuRef 6 85,012,102 - 85,021,750 (-) NCBI HuRef CHM1_1 6 87,892,792 - 87,902,440 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 88,294,252 - 88,303,837 (-) NCBI T2T-CHM13v2.0
Cga Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 34,893,779 - 34,907,374 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 34,893,779 - 34,907,370 (+) Ensembl GRCm39 Ensembl GRCm38 4 34,893,779 - 34,907,374 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 34,893,779 - 34,907,370 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 34,841,028 - 34,854,623 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 35,082,666 - 35,096,261 (+) NCBI MGSCv36 mm8 Celera 4 34,617,733 - 34,630,763 (+) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 16.86 NCBI
Cga Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 14,092,743 - 14,095,302 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 14,092,743 - 14,168,297 (-) NCBI ChiLan1.0 ChiLan1.0
CGA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 107,164,947 - 107,177,621 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 105,061,393 - 105,071,234 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 84,962,974 - 84,972,638 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 88,237,550 - 88,247,051 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 88,236,206 - 88,247,300 (-) Ensembl panpan1.1 panPan2
CGA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 46,610,801 - 46,629,322 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 46,610,973 - 46,636,640 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 46,421,893 - 46,423,957 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 47,386,566 - 47,405,165 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 47,386,743 - 47,405,483 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 46,708,843 - 46,710,907 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 46,638,576 - 46,640,642 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 46,827,170 - 46,829,230 (-) NCBI UU_Cfam_GSD_1.0
Cga Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 81,774,384 - 81,791,558 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936510 4,679,321 - 4,696,529 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936510 4,679,349 - 4,696,511 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CGA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 55,551,320 - 55,568,991 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 55,552,675 - 55,569,057 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 62,245,797 - 62,262,149 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 p21 NCBI
CGA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 11,560,543 - 11,578,070 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 11,560,222 - 11,578,093 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 187,751,845 - 187,768,611 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cga
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 36 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000012385 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
RH139948
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 5 269.7 UniSTS Cytogenetic Map 5 q13-q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
1
51
17
12
4
7
4
2
46
13
43
25
51
8
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012385 ⟹ ENSRNOP00000012385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 49,487,068 - 49,499,191 (+) Ensembl Rnor_6.0 Ensembl 5 50,381,244 - 50,393,367 (+) Ensembl
RefSeq Acc Id:
NM_053918 ⟹ NP_446370
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 54,283,340 - 54,295,464 (+) NCBI mRatBN7.2 5 49,487,068 - 49,499,192 (+) NCBI Rnor_6.0 5 50,381,244 - 50,393,365 (+) NCBI Rnor_5.0 5 54,950,198 - 54,962,319 (+) NCBI RGSC_v3.4 5 51,538,259 - 51,550,324 (+) RGD Celera 5 48,231,474 - 48,243,595 (+) NCBI
Sequence:
GAACAATCGGAGACCAAGTTCCCCTCAGATCGACAATCAACTGCCCAGAACACATCCTTCCAAAGATCCAGAGTTTGCAGGAGAGCTATGGATTGCTACAGAAGATATGCGGCTGTCATTCTGGTCAT
hide sequence
RefSeq Acc Id:
XM_063287072 ⟹ XP_063143142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 54,283,109 - 54,295,464 (+) NCBI
RefSeq Acc Id:
XM_063287073 ⟹ XP_063143143
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 54,283,109 - 54,295,464 (+) NCBI
RefSeq Acc Id:
NP_446370 ⟸ NM_053918
- Peptide Label:
precursor
- UniProtKB:
P11962 (UniProtKB/Swiss-Prot), P70516 (UniProtKB/Swiss-Prot), A0A0F7RQ24 (UniProtKB/TrEMBL), Q6P509 (UniProtKB/TrEMBL)
- Sequence:
MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
hide sequence
Ensembl Acc Id:
ENSRNOP00000012385 ⟸ ENSRNOT00000012385
RefSeq Acc Id:
XP_063143143 ⟸ XM_063287073
- Peptide Label:
isoform X1
- UniProtKB:
P70516 (UniProtKB/Swiss-Prot), P11962 (UniProtKB/Swiss-Prot), A0A0F7RQ24 (UniProtKB/TrEMBL), Q6P509 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143142 ⟸ XM_063287072
- Peptide Label:
isoform X1
- UniProtKB:
P70516 (UniProtKB/Swiss-Prot), P11962 (UniProtKB/Swiss-Prot), A0A0F7RQ24 (UniProtKB/TrEMBL), Q6P509 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-02-04
Cga
glycoprotein hormones, alpha polypeptide
Cga
glycoprotein hormones, alpha subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Cga
glycoprotein hormones, alpha subunit
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Cga
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
precursor protein consists of a 24 amino acid leader sequence and a 96 amino acid alpha subunit apoprotein
632382
