Advanced Search (OLGA)

Gene: Pag1 (phosphoprotein membrane anchor with glycosphingolipid microdomains 1) Rattus norvegicus

Analyze

Symbol:

Pag1

Name:

phosphoprotein membrane anchor with glycosphingolipid microdomains 1

RGD ID:

620394

Description:

Predicted to enable SH2 domain binding activity. Predicted to be involved in intracellular signal transduction and negative regulation of T cell activation. Predicted to be located in plasma membrane. Predicted to be active in membrane raft. Orthologous to human PAG1 (phosphoprotein membrane anchor with glycosphingolipid microdomains 1); PARTICIPATES IN platelet-derived growth factor signaling pathway; INTERACTS WITH alpha-Zearalanol; perfluorooctanoic acid; tetrachloromethane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Cbp; Csk binding protein; csk-binding protein; LOC108349978; phosphoprotein associated with glycosphingolipid microdomains 1; phosphoprotein associated with glycosphingolipid-enriched microdomains 1; transmembrane phosphoprotein Cbp; uncharacterized LOC108349978

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	93,842,747 - 93,984,314 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	93,964,594 - 93,977,227 (+)	Ensembl				GRCr8
mRatBN7.2	2	91,935,378 - 92,076,937 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	92,057,216 - 92,069,849 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	98,547,791 - 98,560,424 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,668,798 - 96,681,431 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	91,725,642 - 91,738,275 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	94,266,104 - 94,277,680 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	94,266,213 - 94,277,676 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	114,018,219 - 114,030,544 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	87,649,094 - 87,661,699 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute lymphoblastic leukemia (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

calcium silicate (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

crotonaldehyde (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

diuron (ISO)

dorsomorphin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fonofos (ISO)

formaldehyde (ISO)

FR900359 (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

irinotecan (ISO)

lipopolysaccharide (ISO)

melphalan (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

ochratoxin A (ISO)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctanoic acid (EXP,ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

progesterone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sotorasib (ISO)

taurine (ISO)

temozolomide (ISO)

terbufos (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

cell surface receptor protein tyrosine kinase signaling pathway (IEA)

immune system process (IEA)

intracellular signal transduction (IBA,IEA,ISO)

negative regulation of T cell activation (IBA,IEA,ISO)

regulation of T cell activation (IEA,ISO)

Cellular Component

membrane raft (IBA,IEA,ISO)

plasma membrane (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

SH2 domain binding (IEA,ISO)

transmembrane receptor protein tyrosine kinase adaptor activity (TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

platelet-derived growth factor signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Transmembrane phosphoprotein Cbp regulates the activities of Src-family tyrosine kinases.	Kawabuchi M, etal., Nature 2000 Apr 27;404(6781):999-1003.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Cutting Edge: Transmembrane phosphoprotein Csk-binding protein/phosphoprotein associated with glycosphingolipid-enriched microdomains as a negative feedback regulator of mast cell signaling through the FcepsilonRI.	Ohtake H, etal., J Immunol 2002 Mar 1;168(5):2087-90.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10790433	PMID:10918051	PMID:12612075	PMID:14613929	PMID:15890337	PMID:21746865	PMID:23548896

Genomics

Comparative Map Data

Pag1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	93,842,747 - 93,984,314 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	93,964,594 - 93,977,227 (+)	Ensembl				GRCr8
mRatBN7.2	2	91,935,378 - 92,076,937 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	92,057,216 - 92,069,849 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	98,547,791 - 98,560,424 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,668,798 - 96,681,431 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	91,725,642 - 91,738,275 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	94,266,104 - 94,277,680 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	94,266,213 - 94,277,676 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	114,018,219 - 114,030,544 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	87,649,094 - 87,661,699 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

PAG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	80,967,810 - 81,112,068 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	80,967,810 - 81,112,116 (-)	Ensembl			hg38	GRCh38
GRCh37	8	81,880,045 - 82,024,303 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	82,042,600 - 82,186,858 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	8	77,885,010 - 78,029,263 (-)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	77,369,813 - 77,514,038 (-)	NCBI		HuRef
CHM1_1	8	81,932,291 - 82,076,435 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	81,399,402 - 81,543,674 (-)	NCBI		T2T-CHM13v2.0

Pag1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	9,752,539 - 9,898,744 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	9,752,539 - 9,898,739 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	9,687,479 - 9,833,684 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	9,687,479 - 9,833,679 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	9,691,898 - 9,833,630 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	9,674,971 - 9,816,162 (-)	NCBI		MGSCv36	mm8
Celera	3	9,712,657 - 9,857,374 (-)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	2.47	NCBI

Pag1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	608,711 - 629,146 (+)	Ensembl
ChiLan1.0	NW_004955444	487,028 - 636,440 (+)	NCBI	ChiLan1.0	ChiLan1.0

PAG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	96,707,238 - 96,851,003 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	72,335,013 - 72,478,833 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	77,492,087 - 77,635,854 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	79,115,801 - 79,218,100 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	79,123,503 - 79,218,100 (-)	Ensembl			panPan2	panpan1.1

PAG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	28,207,445 - 28,340,812 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	28,211,031 - 28,263,322 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	28,483,198 - 28,621,159 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	28,333,786 - 28,471,980 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	28,341,507 - 28,402,630 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	28,386,612 - 28,524,495 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	28,418,572 - 28,556,528 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	28,775,035 - 28,913,070 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pag1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	50,820,083 - 50,961,620 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936656	3,129,084 - 3,143,449 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936656	3,010,603 - 3,152,674 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PAG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	55,506,069 - 55,616,111 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	55,450,824 - 55,619,226 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	60,465,088 - 60,627,627 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PAG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	76,404,120 - 76,541,525 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	76,409,223 - 76,426,138 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	64,652,588 - 64,793,449 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pag1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	10,361,284 - 10,424,207 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624744	10,286,013 - 10,431,383 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pag1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	143,779,891 - 143,865,387 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pag1
1638 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	176	91	90	59	100	59	6	380	200	11	157	97	92	31	23	23

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001439413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB038038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000090023 ⟹ ENSRNOP00000071506

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	92,057,216 - 92,069,845 (+)	Ensembl
Rnor_6.0 Ensembl	2	94,266,213 - 94,277,676 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104062 ⟹ ENSRNOP00000087479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	92,057,216 - 92,069,849 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119112 ⟹ ENSRNOP00000079316

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	92,057,216 - 92,069,849 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000124833 ⟹ ENSRNOP00000099433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	93,964,594 - 93,977,227 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156788 ⟹ ENSRNOP00000101611

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	93,964,594 - 93,977,227 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000159026 ⟹ ENSRNOP00000109503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	93,964,594 - 93,977,223 (+)	Ensembl

RefSeq Acc Id:

NM_022253 ⟹ NP_071589

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,964,594 - 93,977,227 (+)	NCBI
mRatBN7.2	2	92,057,216 - 92,069,849 (+)	NCBI
Rnor_6.0	2	94,266,104 - 94,277,680 (+)	NCBI
Rnor_5.0	2	114,018,219 - 114,030,544 (+)	NCBI
Celera	2	87,649,094 - 87,661,699 (+)	RGD

Sequence:

show sequence

GAGGGAAGCCCTCTAGACCCATGTGATCTCCTGTGAAGAACCGAGCCCACCTGCTGGTCACCCC
AGCTCCCACCATGGGACCTGCAGGAAGCGCCCTGAGCAGCGGGCAGATGCAGATGCAGATGGTG
CTGTGGGGAAGTCTGGCTGCGGTGGCCATGTTCTTCCTCATCACCTTCCTCATCCTTCTGTGCT
CCAGTTGTGACAGAGACAAGAAGCCACGGCAGCATAGTGGAGACCATGAGAGCCTGATGAATGT
GCCTTCCGACAAGGAGATGTTCAGCCATTCAGCGACCAGCCTGACCACAGATGCACTGGCCAGC
AGCGAACAGAATGGGGTGCTCACCAACGGCGACATTCTTTCAGAAGACAGCACAATGACCTGCA
TGCAGCATTATGAGGAAGTCCAGACCTCAGCTTCAGATCTGCTGGACTCCCAGGACAGCACGGG
AAAGGCCAAGTGCCACCAGAGCCGGGAACTGCCCAGAATCCCGCCTGAGAACGCAGTGGACGCG
ATGCTCACCGCCAGGGCCGCAGATGGGGACTCCGGGCCCGGCGTGGAGGGGCCCTACGAGGTGC
TCAAGGATAGTTCCTCCCAGGAGAACATGGTGGAGGACTGCTTGTATGAGACAGTGAAGGAAAT
CAAGGAGGTGGCAGACAAAAGCCAGGGCGGCAAGTCCAAGTCCACTTCTGCCCTGAAGGAGCTT
CAGGGGGCCCACGCCGAGGGCAAGGCCGACTTTGCTGAATACGCCTCTGTGGACAGAAACAAAA
AGTGCCGCCACAGCACAAATGCAGAGAGCATTCTGGGAACGTCCAGTGACCTGGATGAGGAAAC
CCCACCGCCTGTCCCAGTTAAACTTCTGGATGAGAATGCCAACCTTCCAGAGAAGGGAGAGCAC
GGGGCAGAAGAGCAAGCTCCAGAAGCACCCAGTGGACACAGCAAGAGATTTAGTTCCTTGTCAT
ACAAGTCTCGAGAAGAAGACCCAACTCTTACAGAAGAGGAGATCTCAGCAATGTATTCTTCAGT
GAATAAGCCTGGACAATCGGCACACAAACCTGGGCCGGAATCTACCTGCCAGTGCCCGCAGGGT
CCCCCTCAGAGGTCATCATCTTCCTGTAACGACCTCTATGCCACTGTGAAAGACTTCGAGAAAA
CTCCCAACAGCATCAGCATGCTGCCACCAGCAAGGAGGCCCGGTGAGGAACCAGAGCCTGACTA
TGAAGCCATACAGACTCTAAACAGAGAGGACGACAAGGTCCCTCTGGGGACCAATGGCCACCTT
GTCCCCAAGGAGAATGACTATGAGAGCATTGGGGACTTGCAGCAAGGCAGGGATGTCACCAGGC
TCTAGCAAC

hide sequence

RefSeq Acc Id:

XM_039103031 ⟹ XP_038958959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,842,747 - 93,984,314 (+)	NCBI
mRatBN7.2	2	91,935,378 - 92,076,937 (+)	NCBI

RefSeq Acc Id:

XM_039103032 ⟹ XP_038958960

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,842,747 - 93,984,314 (+)	NCBI
mRatBN7.2	2	91,935,378 - 92,076,937 (+)	NCBI

RefSeq Acc Id:

XM_063282449 ⟹ XP_063138519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,966,110 - 93,984,314 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001426342	(Get FASTA)	NCBI Sequence Viewer
	NP_071589	(Get FASTA)	NCBI Sequence Viewer
	XP_038958959	(Get FASTA)	NCBI Sequence Viewer
	XP_038958960	(Get FASTA)	NCBI Sequence Viewer
	XP_063138519	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA95413	(Get FASTA)	NCBI Sequence Viewer
	EDM01002	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000079316.1
	ENSRNOP00000099433
GenBank Protein	Q9JM80	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071589 ⟸ NM_022253

- UniProtKB:

Q9JM80 (UniProtKB/Swiss-Prot), A0A8I6A7U7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGPAGSALSSGQMQMQMVLWGSLAAVAMFFLITFLILLCSSCDRDKKPRQHSGDHESLMNVPSD
KEMFSHSATSLTTDALASSEQNGVLTNGDILSEDSTMTCMQHYEEVQTSASDLLDSQDSTGKAK
CHQSRELPRIPPENAVDAMLTARAADGDSGPGVEGPYEVLKDSSSQENMVEDCLYETVKEIKEV
ADKSQGGKSKSTSALKELQGAHAEGKADFAEYASVDRNKKCRHSTNAESILGTSSDLDEETPPP
VPVKLLDENANLPEKGEHGAEEQAPEAPSGHSKRFSSLSYKSREEDPTLTEEEISAMYSSVNKP
GQSAHKPGPESTCQCPQGPPQRSSSSCNDLYATVKDFEKTPNSISMLPPARRPGEEPEPDYEAI
QTLNREDDKVPLGTNGHLVPKENDYESIGDLQQGRDVTRL

hide sequence

Ensembl Acc Id:

ENSRNOP00000071506 ⟸ ENSRNOT00000090023

RefSeq Acc Id:	XP_038958960 ⟸ XM_039103032
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038958959 ⟸ XM_039103031
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000079316 ⟸ ENSRNOT00000119112

Ensembl Acc Id:

ENSRNOP00000087479 ⟸ ENSRNOT00000104062

RefSeq Acc Id:	XP_063138519 ⟸ XM_063282449
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K0M5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000101611 ⟸ ENSRNOT00000156788

Ensembl Acc Id:

ENSRNOP00000109503 ⟸ ENSRNOT00000159026

Ensembl Acc Id:

ENSRNOP00000099433 ⟸ ENSRNOT00000124833

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JM80-F1-model_v2	AlphaFold	Q9JM80	1-424	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620394	AgrOrtholog
BioCyc Gene	G2FUF-53739	BioCyc
Ensembl Genes	ENSRNOG00000061328	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000087915	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000119112.1	UniProtKB/Swiss-Prot
	ENSRNOT00000124833	ENTREZGENE
InterPro	PAG	UniProtKB/Swiss-Prot
KEGG Report	rno:64019	UniProtKB/Swiss-Prot
NCBI Gene	64019	ENTREZGENE
PANTHER	PHOSPHOPROTEIN ASSOCIATED WITH GLYCOSPHINGOLIPID-ENRICHED MICRODOMAINS 1	UniProtKB/Swiss-Prot
	PTHR16322	UniProtKB/Swiss-Prot
Pfam	PAG	UniProtKB/Swiss-Prot
PhenoGen	Pag1	PhenoGen
RatGTEx	ENSRNOG00000061328	RatGTEx
	ENSRNOG00000087915	RatGTEx
UniProt	A0A0G2K0M5	ENTREZGENE
	A0A8I6A7U7	ENTREZGENE
	A0ABK0LEI1_RAT	UniProtKB/TrEMBL
	A0ABK0LTU1_RAT	UniProtKB/TrEMBL
	PHAG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pag1	phosphoprotein membrane anchor with glycosphingolipid microdomains 1	LOC108349978	uncharacterized LOC108349978	Data merged from RGD:11387324	737654	PROVISIONAL
2016-08-02	LOC108349978	uncharacterized LOC108349978			Symbol and Name status set to provisional	70820	PROVISIONAL
2014-05-07	Pag1	phosphoprotein membrane anchor with glycosphingolipid microdomains 1	Pag1	phosphoprotein associated with glycosphingolipid microdomains 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-07-31	Pag1	phosphoprotein associated with glycosphingolipid microdomains 1	Cbp	Csk binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-08-07	Cbp	Csk binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)