Symbol:
Ecm1
Name:
extracellular matrix protein 1
RGD ID:
620357
Description:
Predicted to enable interleukin-2 receptor binding activity and protease binding activity. Predicted to be involved in several processes, including negative regulation of bone mineralization; positive regulation of canonical NF-kappaB signal transduction; and positive regulation of endothelial cell proliferation. Predicted to act upstream of or within several processes, including regulation of T cell migration; regulation of type 2 immune response; and skeletal system development. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Human ortholog(s) of this gene implicated in lipoid proteinosis. Orthologous to human ECM1 (extracellular matrix protein 1); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
secretory component p85
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ECM1 (extracellular matrix protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ecm1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ecm1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ECM1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ECM1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ecm1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ECM1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ECM1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ecm1 (extracellular matrix protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ecm1 (extracellular matrix protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ECM1 (extracellular matrix protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ecm1b (extracellular matrix protein 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ecm1a (extracellular matrix protein 1a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,976,439 - 185,981,656 (-) NCBI GRCr8 mRatBN7.2 2 183,287,491 - 183,292,729 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 183,287,322 - 183,292,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,952,324 - 190,957,491 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 188,747,934 - 188,753,625 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,584,856 - 183,590,023 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 197,855,468 - 197,860,973 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 197,855,460 - 197,860,699 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 217,345,268 - 217,350,509 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,525,156 - 190,530,323 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,489,759 - 190,489,956 (-) NCBI Celera 2 175,817,503 - 175,822,670 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ecm1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ECM1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ECM1 mRNA CTD PMID:22079256 Ecm1 Rat (S)-nicotine multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ecm1 Rat 1,2-dibromoethane decreases expression ISO Ecm1 (Mus musculus) 6480464 Ethylene Dibromide results in decreased expression of ECM1 mRNA CTD PMID:15612046 Ecm1 Rat 1,2-dimethylhydrazine increases expression ISO Ecm1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ECM1 mRNA CTD PMID:22206623 Ecm1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ecm1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ECM1 mRNA] CTD PMID:22206623 Ecm1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ecm1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Ecm1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ecm1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ECM1 mRNA CTD PMID:17557909 Ecm1 Rat 17beta-estradiol multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of ECM1 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of ECM1 mRNA CTD PMID:20226447 and PMID:30165855 Ecm1 Rat 17beta-estradiol decreases expression ISO Ecm1 (Mus musculus) 6480464 Estradiol results in decreased expression of ECM1 mRNA CTD PMID:39298647 Ecm1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Ecm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ecm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ECM1 mRNA CTD PMID:21570461 Ecm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ECM1 mRNA CTD PMID:34747641 Ecm1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ECM1 mRNA CTD PMID:32109520 and PMID:33387578 Ecm1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ecm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ECM1 mRNA CTD PMID:26290441 Ecm1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ecm1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ecm1 Rat 2,6-dimethoxyphenol multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of ECM1 protein CTD PMID:38598786 Ecm1 Rat 2-hydroxypropanoic acid decreases expression ISO ECM1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ECM1 mRNA CTD PMID:30851411 Ecm1 Rat 2-nitrotoluene decreases expression ISO Ecm1 (Mus musculus) 6480464 2-nitrotoluene results in decreased expression of ECM1 mRNA CTD PMID:15612046 Ecm1 Rat 2-palmitoylglycerol increases expression ISO ECM1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ECM1 mRNA CTD PMID:37199045 Ecm1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Ecm1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ECM1 mRNA CTD PMID:28522335 Ecm1 Rat 3-methylcholanthrene increases expression ISO Ecm1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of ECM1 mRNA CTD PMID:20713471 Ecm1 Rat 3-Nitrobenzanthrone affects expression ISO ECM1 (Homo sapiens) 6480464 3-nitrobenzanthrone affects the expression of ECM1 mRNA CTD PMID:34036453 Ecm1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ECM1 mRNA CTD PMID:30723492 Ecm1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ecm1 (Mus musculus) 6480464 bisphenol S results in increased expression of ECM1 mRNA CTD PMID:30951980 Ecm1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ecm1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ECM1 mRNA CTD PMID:39298647 Ecm1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Ecm1 (Mus musculus) 6480464 Fenretinide results in decreased expression of ECM1 mRNA CTD PMID:28973697 Ecm1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ECM1 mRNA CTD PMID:31881176 Ecm1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ECM1 mRNA CTD PMID:28959563 Ecm1 Rat actinomycin D multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ECM1 mRNA CTD PMID:38460933 Ecm1 Rat aflatoxin B1 increases methylation ISO ECM1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ECM1 gene CTD PMID:27153756 Ecm1 Rat all-trans-retinoic acid multiple interactions ISO Ecm1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ECM1 mRNA and [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ECM1 mRNA CTD PMID:30951980 and PMID:36189433 Ecm1 Rat all-trans-retinoic acid increases expression ISO Ecm1 (Mus musculus) 6480464 Tretinoin results in increased expression of ECM1 mRNA CTD PMID:36189433 Ecm1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ECM1 mRNA CTD PMID:35163327 Ecm1 Rat aluminium atom increases expression ISO Ecm1 (Mus musculus) 6480464 Aluminum results in increased expression of ECM1 mRNA CTD PMID:37544489 Ecm1 Rat aluminium(0) increases expression ISO Ecm1 (Mus musculus) 6480464 Aluminum results in increased expression of ECM1 mRNA CTD PMID:37544489 Ecm1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ECM1 mRNA CTD PMID:16483693 Ecm1 Rat aristolochic acid A decreases expression ISO ECM1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ECM1 mRNA and aristolochic acid I results in decreased expression of ECM1 protein CTD PMID:33212167 Ecm1 Rat arsenous acid increases expression ISO ECM1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ECM1 mRNA CTD PMID:20458559 Ecm1 Rat benzo[a]pyrene increases expression ISO Ecm1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ECM1 mRNA CTD PMID:21569818 Ecm1 Rat benzo[a]pyrene increases methylation ISO ECM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ECM1 promoter CTD PMID:27901495 Ecm1 Rat benzo[a]pyrene multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ECM1 mRNA CTD PMID:27858113 Ecm1 Rat benzo[b]fluoranthene increases expression ISO Ecm1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ECM1 mRNA CTD PMID:26377693 Ecm1 Rat benzo[b]fluoranthene multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ECM1 mRNA CTD PMID:27858113 Ecm1 Rat benzoates decreases expression ISO ECM1 (Homo sapiens) 6480464 Benzoates analog results in decreased expression of ECM1 mRNA CTD PMID:29472718 Ecm1 Rat beta-lapachone increases expression ISO ECM1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ECM1 mRNA CTD PMID:38218311 Ecm1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ECM1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ECM1 mRNA CTD PMID:31163220 Ecm1 Rat bisphenol A decreases expression ISO Ecm1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ECM1 mRNA CTD PMID:26063408 Ecm1 Rat bisphenol A increases expression ISO Ecm1 (Mus musculus) 6480464 bisphenol A results in increased expression of ECM1 mRNA CTD PMID:30951980 and PMID:38701888 Ecm1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ECM1 mRNA CTD PMID:30903817 Ecm1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ECM1 mRNA CTD PMID:30816183 and PMID:32528016 Ecm1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ECM1 mRNA CTD PMID:25181051 Ecm1 Rat bisphenol F increases expression ISO Ecm1 (Mus musculus) 6480464 bisphenol F results in increased expression of ECM1 mRNA CTD PMID:30951980 Ecm1 Rat bisphenol F multiple interactions ISO Ecm1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ECM1 mRNA CTD PMID:30951980 Ecm1 Rat butanal increases expression ISO ECM1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ECM1 mRNA CTD PMID:26079696 Ecm1 Rat cadmium dichloride increases expression ISO ECM1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ECM1 mRNA CTD PMID:38382870 and PMID:38568856 Ecm1 Rat caffeine multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ecm1 Rat calcitriol decreases expression ISO ECM1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of ECM1 mRNA CTD PMID:26485663 Ecm1 Rat camptothecin increases expression ISO ECM1 (Homo sapiens) 6480464 Camptothecin results in increased expression of ECM1 mRNA CTD PMID:38460933 Ecm1 Rat carbon nanotube decreases expression ISO Ecm1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ECM1 mRNA CTD PMID:25620056 Ecm1 Rat carbon nanotube increases expression ISO Ecm1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ecm1 Rat chrysene increases expression ISO Ecm1 (Mus musculus) 6480464 chrysene results in increased expression of ECM1 mRNA CTD PMID:26377693 Ecm1 Rat chrysene multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ECM1 mRNA CTD PMID:27858113 Ecm1 Rat cisplatin multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] affects the expression of ECM1 mRNA CTD PMID:20705681 Ecm1 Rat copper(II) chloride increases expression ISO ECM1 (Homo sapiens) 6480464 cupric chloride results in increased expression of ECM1 mRNA CTD PMID:38568856 Ecm1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ECM1 mRNA CTD PMID:26577399 Ecm1 Rat deoxynivalenol decreases expression ISO ECM1 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of ECM1 mRNA CTD PMID:31863870 Ecm1 Rat diarsenic trioxide increases expression ISO ECM1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ECM1 mRNA CTD PMID:20458559 Ecm1 Rat dibenz[a,h]anthracene increases expression ISO Ecm1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ecm1 Rat Dibutyl phosphate affects expression ISO ECM1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ECM1 mRNA CTD PMID:37042841 Ecm1 Rat diclofenac decreases expression ISO Ecm1 (Mus musculus) 6480464 Diclofenac results in decreased expression of ECM1 mRNA CTD PMID:26934552 Ecm1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of ECM1 mRNA CTD PMID:21658437 Ecm1 Rat doxorubicin increases expression ISO ECM1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ECM1 mRNA CTD PMID:29803840 and PMID:30031762 Ecm1 Rat ethanol multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of ECM1 mRNA CTD PMID:30517762 Ecm1 Rat fenthion increases expression ISO Ecm1 (Mus musculus) 6480464 Fenthion results in increased expression of ECM1 mRNA CTD PMID:34813904 Ecm1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ECM1 mRNA CTD PMID:34044035 Ecm1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ECM1 mRNA CTD PMID:24136188 Ecm1 Rat folic acid multiple interactions ISO Ecm1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ECM1 mRNA] CTD PMID:22206623 Ecm1 Rat folpet decreases expression ISO Ecm1 (Mus musculus) 6480464 folpet results in decreased expression of ECM1 mRNA CTD PMID:31558096 Ecm1 Rat furfural multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ECM1 protein CTD PMID:38598786 Ecm1 Rat glycidol decreases expression ISO Ecm1 (Mus musculus) 6480464 glycidol results in decreased expression of ECM1 mRNA CTD PMID:15612046 Ecm1 Rat inulin multiple interactions ISO Ecm1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ECM1 mRNA CTD PMID:36331819 Ecm1 Rat isoprenaline increases expression ISO Ecm1 (Mus musculus) 6480464 Isoproterenol results in increased expression of ECM1 mRNA CTD PMID:20003209 Ecm1 Rat ivermectin increases expression ISO ECM1 (Homo sapiens) 6480464 Ivermectin results in increased expression of ECM1 protein CTD PMID:32959892 Ecm1 Rat lead diacetate increases expression ISO ECM1 (Homo sapiens) 6480464 lead acetate results in increased expression of ECM1 mRNA CTD PMID:38568856 Ecm1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of ECM1 mRNA CTD PMID:24136188 Ecm1 Rat methidathion increases expression ISO Ecm1 (Mus musculus) 6480464 methidathion results in increased expression of ECM1 mRNA CTD PMID:34813904 Ecm1 Rat methyl carbamate decreases expression ISO Ecm1 (Mus musculus) 6480464 methyl carbamate results in decreased expression of ECM1 mRNA CTD PMID:15612046 Ecm1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Ecm1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of ECM1 mRNA CTD PMID:22401849 Ecm1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Ecm1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ECM1 mRNA CTD PMID:36189433 Ecm1 Rat N-nitrosodiethylamine decreases expression ISO Ecm1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of ECM1 mRNA CTD PMID:24535843 Ecm1 Rat N-nitrosodiethylamine multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of ECM1 mRNA CTD PMID:24535843 Ecm1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ECM1 mRNA CTD PMID:24136188 Ecm1 Rat nickel sulfate increases expression ISO ECM1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of ECM1 mRNA CTD PMID:18651567 Ecm1 Rat nicotine multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ecm1 Rat Nutlin-3 multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ECM1 mRNA CTD PMID:38460933 Ecm1 Rat ozone multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ECM1 mRNA CTD PMID:34911549 Ecm1 Rat paclitaxel multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] affects the expression of ECM1 mRNA CTD PMID:20705681 Ecm1 Rat paracetamol affects expression ISO Ecm1 (Mus musculus) 6480464 Acetaminophen affects the expression of ECM1 mRNA CTD PMID:17562736 Ecm1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ECM1 mRNA CTD PMID:33387578 Ecm1 Rat pentachlorophenol increases expression ISO Ecm1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of ECM1 mRNA CTD PMID:23892564 Ecm1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ecm1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ECM1 mRNA CTD PMID:36331819 Ecm1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ECM1 mRNA CTD PMID:35163327 Ecm1 Rat phenethyl isothiocyanate increases expression EXP 6480464 phenethyl isothiocyanate results in increased expression of ECM1 mRNA CTD PMID:17616710 Ecm1 Rat phenobarbital multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of ECM1 mRNA and NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of ECM1 mRNA] CTD PMID:19482888 and PMID:24535843 Ecm1 Rat phenobarbital decreases expression ISO Ecm1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of ECM1 mRNA CTD PMID:19482888 Ecm1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ECM1 mRNA CTD PMID:18158353 Ecm1 Rat pirinixic acid multiple interactions ISO ECM1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ECM1 mRNA CTD PMID:19710929 Ecm1 Rat potassium chromate increases expression ISO ECM1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of ECM1 mRNA CTD PMID:22079256 Ecm1 Rat potassium chromate multiple interactions ISO ECM1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ECM1 mRNA CTD PMID:22079256 Ecm1 Rat potassium dichromate increases expression ISO ECM1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of ECM1 protein CTD PMID:23718831 Ecm1 Rat progesterone multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of ECM1 mRNA CTD PMID:20226447 Ecm1 Rat propanal increases expression ISO ECM1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ECM1 mRNA CTD PMID:26079696 Ecm1 Rat rac-lactic acid decreases expression ISO ECM1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ECM1 mRNA CTD PMID:30851411 Ecm1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ECM1 mRNA CTD PMID:28374803 Ecm1 Rat silicon dioxide increases expression ISO ECM1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of ECM1 mRNA CTD PMID:25895662 Ecm1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ECM1 mRNA CTD PMID:22431001 Ecm1 Rat sodium arsenite increases expression ISO ECM1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ECM1 mRNA CTD PMID:34032870 and PMID:38568856 Ecm1 Rat sodium chloride multiple interactions ISO ECM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ECM1 protein more ... CTD PMID:38598786 Ecm1 Rat sodium dichromate decreases expression ISO Ecm1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of ECM1 mRNA CTD PMID:31558096 Ecm1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ECM1 mRNA CTD PMID:19281266 Ecm1 Rat sunitinib decreases expression ISO ECM1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ECM1 mRNA CTD PMID:31533062 Ecm1 Rat temozolomide decreases expression ISO ECM1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ECM1 mRNA CTD PMID:31758290 Ecm1 Rat tetrachloromethane decreases expression ISO Ecm1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ECM1 mRNA CTD PMID:17484886 Ecm1 Rat tetrachloromethane multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of ECM1 mRNA CTD PMID:30517762 Ecm1 Rat tetraphene multiple interactions ISO Ecm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ECM1 mRNA CTD PMID:27858113 Ecm1 Rat thiram increases expression ISO ECM1 (Homo sapiens) 6480464 Thiram results in increased expression of ECM1 mRNA CTD PMID:38568856 Ecm1 Rat trichloroethene multiple interactions ISO Ecm1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in decreased expression of ECM1 mRNA] CTD PMID:15363585 Ecm1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ECM1 mRNA CTD PMID:17905399 Ecm1 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of ECM1 mRNA CTD PMID:30589522 Ecm1 Rat troglitazone increases expression ISO Ecm1 (Mus musculus) 6480464 troglitazone results in increased expression of ECM1 mRNA CTD PMID:28973697 Ecm1 Rat urethane increases expression ISO ECM1 (Homo sapiens) 6480464 Urethane results in increased expression of ECM1 mRNA CTD PMID:28818685 Ecm1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ECM1 mRNA CTD PMID:19015723 Ecm1 Rat vorinostat increases expression EXP 6480464 vorinostat results in increased expression of ECM1 mRNA CTD PMID:20060208 Ecm1 Rat zoledronic acid increases expression ISO ECM1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ECM1 mRNA CTD PMID:24714768
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2-dibromoethane (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 2-nitrotoluene (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 3-methylcholanthrene (ISO) 3-Nitrobenzanthrone (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aluminium atom (ISO) aluminium(0) (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzoates (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) camptothecin (ISO) carbon nanotube (ISO) chrysene (ISO) cisplatin (ISO) copper(II) chloride (ISO) Cuprizon (EXP) deoxynivalenol (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) ethanol (ISO) fenthion (ISO) fipronil (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) furfural (ISO) glycidol (ISO) inulin (ISO) isoprenaline (ISO) ivermectin (ISO) lead diacetate (ISO) leflunomide (EXP) methidathion (ISO) methyl carbamate (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (ISO) nefazodone (EXP) nickel sulfate (ISO) nicotine (ISO) Nutlin-3 (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (EXP) phenobarbital (ISO) phenylephrine (EXP) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) progesterone (ISO) propanal (ISO) rac-lactic acid (ISO) rotenone (EXP) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (ISO) Soman (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) tetraphene (ISO) thiram (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (EXP) troglitazone (ISO) urethane (ISO) vinclozolin (EXP) vorinostat (EXP) zoledronic acid (ISO)
Biological Process
angiogenesis (IEA) biological_process (ND) biomineral tissue development (IEA) chondrocyte development (IEA,ISO) endochondral bone growth (IEA,ISO) inflammatory response (IEA,ISO) negative regulation of bone mineralization (IEA,ISO,ISS) negative regulation of cytokine-mediated signaling pathway (IEA,ISO) negative regulation of peptidase activity (ISO,ISS) ossification (IEA) positive regulation of angiogenesis (IEA,ISO,ISS) positive regulation of canonical NF-kappaB signal transduction (ISO) positive regulation of endothelial cell proliferation (IEA,ISO,ISS) regulation of bone mineralization (IBA,IEA,ISO) regulation of T cell migration (IEA,ISO) regulation of transcription by RNA polymerase II (IEA,ISO) regulation of type 2 immune response (IEA,ISO) signal transduction (IEA)
1.
Molecular cloning, characterization, and genetic mapping of the cDNA coding for a novel secretory protein of mouse. Demonstration of alternative splicing in skin and cartilage.
Bhalerao J, etal., J Biol Chem 1995 Jul 7;270(27):16385-94.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Lipoid proteinosis maps to 1q21 and is caused by mutations in the extracellular matrix protein 1 gene (ECM1).
Hamada T, etal., Hum Mol Genet 2002 Apr 1;11(7):833-40.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
Ecm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,976,439 - 185,981,656 (-) NCBI GRCr8 mRatBN7.2 2 183,287,491 - 183,292,729 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 183,287,322 - 183,292,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,952,324 - 190,957,491 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 188,747,934 - 188,753,625 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,584,856 - 183,590,023 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 197,855,468 - 197,860,973 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 197,855,460 - 197,860,699 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 217,345,268 - 217,350,509 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,525,156 - 190,530,323 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,489,759 - 190,489,956 (-) NCBI Celera 2 175,817,503 - 175,822,670 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
ECM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 150,508,109 - 150,513,789 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 150,508,062 - 150,513,789 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 150,480,585 - 150,486,265 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 148,747,207 - 148,752,660 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 123,596,250 - 123,602,028 (+) NCBI Celera Cytogenetic Map 1 q21.2 NCBI HuRef 1 121,858,654 - 121,864,432 (+) NCBI HuRef CHM1_1 1 151,876,297 - 151,882,073 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 149,632,949 - 149,638,627 (+) NCBI T2T-CHM13v2.0
Ecm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 95,641,459 - 95,646,880 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 95,641,459 - 95,646,881 (-) Ensembl GRCm39 Ensembl GRCm38 3 95,734,147 - 95,739,876 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 95,734,147 - 95,739,569 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 95,538,071 - 95,543,492 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 95,819,554 - 95,824,967 (-) NCBI MGSCv36 mm8 Celera 3 97,167,107 - 97,172,528 (-) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.91 NCBI
Ecm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 290,363 - 299,130 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 293,295 - 299,293 (-) NCBI ChiLan1.0 ChiLan1.0
ECM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 99,324,741 - 99,330,326 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 99,069,972 - 99,084,160 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 125,853,337 - 125,858,904 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 129,502,041 - 129,507,819 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 129,502,041 - 129,507,819 (+) Ensembl panpan1.1 panPan2
ECM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 59,696,125 - 59,701,990 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 59,696,477 - 59,701,744 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 59,142,307 - 59,148,147 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 60,711,672 - 60,717,511 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 60,697,493 - 60,717,511 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 59,542,109 - 59,547,950 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 59,625,886 - 59,631,725 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 60,353,552 - 60,359,392 (+) NCBI UU_Cfam_GSD_1.0
Ecm1
ECM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 98,615,778 - 98,621,836 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 98,615,776 - 98,633,081 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 107,904,906 - 107,909,543 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ECM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666038 12,777,257 - 12,783,212 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ecm1
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 39 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000028740 Prediction methods: Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
Ecm1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,292,489 - 183,292,676 (+) MAPPER mRatBN7.2 Rnor_6.0 2 197,860,466 - 197,860,652 NCBI Rnor6.0 Rnor_5.0 2 217,350,266 - 217,350,452 UniSTS Rnor5.0 RGSC_v3.4 2 190,530,154 - 190,530,340 UniSTS RGSC3.4 Celera 2 175,822,501 - 175,822,687 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028740 ⟹ ENSRNOP00000028740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 183,287,322 - 183,292,671 (-) Ensembl Rnor_6.0 Ensembl 2 197,855,460 - 197,860,699 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105287 ⟹ ENSRNOP00000085798
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 183,287,492 - 183,291,472 (-) Ensembl
RefSeq Acc Id:
NM_053882 ⟹ NP_446334
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,976,439 - 185,981,606 (-) NCBI mRatBN7.2 2 183,287,491 - 183,292,659 (-) NCBI Rnor_6.0 2 197,855,468 - 197,860,635 (-) NCBI Rnor_5.0 2 217,345,268 - 217,350,509 (-) NCBI RGSC_v3.4 2 190,525,156 - 190,530,323 (-) RGD Celera 2 175,817,503 - 175,822,670 (-) RGD
Sequence:
GCAGCAGCCAGAGGAGCAGGCTTGCAGCAAGTGGCCCAGCCCCTTCAGGTCTAGATCTGCCTGTGACAACTGCTGCTGGGTGACCCGTGACCAGTTCTTACCCCAGGATGGGGACCATACGCAGCTCA
hide sequence
RefSeq Acc Id:
XM_006232942 ⟹ XP_006233004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,976,439 - 185,981,656 (-) NCBI mRatBN7.2 2 183,287,491 - 183,292,719 (-) NCBI Rnor_6.0 2 197,855,468 - 197,860,973 (-) NCBI Rnor_5.0 2 217,345,268 - 217,350,509 (-) NCBI
Sequence:
ATCCCCAAGTAAAATTCTTAGTGCCCGTCCCCCCACTTCATTCAGGAGGGTGCCAGATCCCCTCTCTATAAAGGACAATACGCAGGAGGGAAGCCCAGACACAAGTTAAGGGTGCAGTGCCAACTTGC
hide sequence
RefSeq Acc Id:
XM_039101580 ⟹ XP_038957508
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,976,439 - 185,981,652 (-) NCBI mRatBN7.2 2 183,287,491 - 183,292,718 (-) NCBI
RefSeq Acc Id:
XM_063281170 ⟹ XP_063137240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,976,439 - 185,981,654 (-) NCBI
RefSeq Acc Id:
NP_446334 ⟸ NM_053882
- Peptide Label:
precursor
- UniProtKB:
Q5U2S9 (UniProtKB/Swiss-Prot), Q62894 (UniProtKB/Swiss-Prot), A6K307 (UniProtKB/TrEMBL), A0A8L2QGP4 (UniProtKB/TrEMBL)
- Sequence:
MGTIRSSALILACLALASAASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIP
hide sequence
RefSeq Acc Id:
XP_006233004 ⟸ XM_006232942
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QGP4 (UniProtKB/TrEMBL)
- Sequence:
MGTIRSSALILACLALASAASEGAFKVSDQREMKPEHLFQHLHEGYAAPPSPPQTRRLQVHHSE
hide sequence
Ensembl Acc Id:
ENSRNOP00000028740 ⟸ ENSRNOT00000028740
RefSeq Acc Id:
XP_038957508 ⟸ XM_039101580
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QGP4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085798 ⟸ ENSRNOT00000105287
RefSeq Acc Id:
XP_063137240 ⟸ XM_063281170
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2QGP4 (UniProtKB/TrEMBL)
RGD ID: 13691555 Promoter ID: EPDNEW_R2079 Type: multiple initiation site Name: Ecm1_1 Description: extracellular matrix protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 197,860,647 - 197,860,707 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Ecm1
extracellular matrix protein 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Ecm1
extracellular matrix protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
