Advanced Search (OLGA)

Gene: Mmp10 (matrix metallopeptidase 10) Rattus norvegicus

Analyze

Symbol:

Mmp10

Name:

matrix metallopeptidase 10

RGD ID:

620192

Description:

Predicted to enable metalloendopeptidase activity. Predicted to be involved in collagen catabolic process and extracellular matrix organization. Predicted to act upstream of or within regulation of cell migration. Predicted to be located in extracellular matrix and extracellular region. Orthologous to human MMP10 (matrix metallopeptidase 10); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2-amino-2-deoxy-D-glucopyranose.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

matrix metallopeptidase 10 (stromelysin 2); matrix metalloproteinase 10; matrix metalloproteinase-10; MMP-10; SL-2; stromelysin 2; stromelysin-2; transformation-associated protein 34A; transin-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MMP10 (matrix metallopeptidase 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Mmp10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mmp10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MMP10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mmp10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MMP10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mmp10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mmp10 (matrix metallopeptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MMP3 (matrix metallopeptidase 3)	HGNC	OrthoDB, Panther, Treefam
Homo sapiens (human):	TMEM200A (transmembrane protein 200A)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Mmp10 (matrix metallopeptidase 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MMP10 (matrix metallopeptidase 10)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zmp-5	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zmp-5	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zmp-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	zmp-6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	LOC100491214	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100491547	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	12,974,707 - 12,982,613 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	12,974,707 - 12,982,613 (+)	Ensembl				GRCr8
mRatBN7.2	8	4,689,840 - 4,697,748 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	4,689,840 - 4,697,748 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	8,649,536 - 8,657,457 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	6,947,308 - 6,955,231 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	4,949,505 - 4,957,411 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	5,734,348 - 5,742,243 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	5,734,348 - 5,742,243 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	5,737,196 - 5,745,091 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	4,367,842 - 4,375,737 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	6,249,460 - 6,257,355 (+)	NCBI		Celera
RGSC_v3.1	8	4,367,841 - 4,375,737 (+)	NCBI
Cytogenetic Map	8	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenoleukodystrophy (ISO)

asthma (ISO)

contact dermatitis (ISO)

diabetes mellitus (ISO)

end stage renal disease (ISO)

Lung Neoplasms (ISO)

Neoplasm Metastasis (ISO)

rheumatoid arthritis (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

3,4-dichloroaniline (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-nitroquinoline N-oxide (ISO)

5-aza-2'-deoxycytidine (ISO)

6alpha-methylprednisolone (ISO)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

acrolein (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (EXP)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

alpha-hexylcinnamaldehyde (ISO)

ammonium chloride (EXP)

azathioprine (ISO)

Azoxymethane (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (EXP)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

chloramphenicol (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

chrysin (ISO)

cisplatin (ISO)

clothianidin (ISO)

clozapine (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (ISO)

curcumin (ISO)

cyclosporin A (ISO)

cypermethrin (ISO)

deoxycholic acid (ISO)

dextran sulfate (ISO)

dihydroxyacetone (ISO)

dimethylarsinous acid (ISO)

disulfiram (ISO)

diuron (ISO)

doxorubicin (ISO)

flavonoids (EXP)

fluoranthene (ISO)

formaldehyde (EXP)

genistein (EXP,ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

graphite (EXP)

haloperidol (ISO)

hydralazine (ISO)

indometacin (EXP)

isotretinoin (ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

malathion (ISO)

mechlorethamine (EXP)

mercaptopurine (EXP)

metformin (ISO)

methotrexate (ISO)

methoxychlor (EXP)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

microcystin-LR (ISO)

mifepristone (ISO)

Muraglitazar (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-acetyl-L-cysteine (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

organoselenium compound (ISO)

ozone (EXP)

paclitaxel (ISO)

paracetamol (ISO)

PD 0325901 (ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

piroxicam (ISO)

prednisolone (ISO)

progesterone (ISO)

propanal (ISO)

purine-6-thiol (EXP)

quercetin (ISO)

resorcinol (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

Salinomycin (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

stattic (ISO)

succimer (ISO)

sulindac sulfide (ISO)

tartrazine (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

troglitazone (EXP)

urethane (ISO)

valproic acid (ISO)

XL147 (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

collagen catabolic process (IBA,IEA)

extracellular matrix organization (IBA)

proteolysis (IEA)

regulation of cell migration (ISO)

Cellular Component

extracellular matrix (IEA)

Molecular Function

hydrolase activity (IEA)

metal ion binding (IEA)

metalloendopeptidase activity (IBA,IEA)

metallopeptidase activity (IEA)

peptidase activity (IEA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Sequences coding for part of oncogene-induced transin are highly conserved in a related rat gene.	Breathnach R, etal., Nucleic Acids Res 1987 Feb 11;15(3):1139-51.
2.	Molecular cloning and characterization of v-mos-activated transformation-associated proteins.	Chan JC, etal., J Biol Chem 1992 Jan 15;267(2):1099-103.
3.	Transformation of normal rat kidney cells by v-K-ras enhances expression of transin 2 and an S-100-related calcium-binding protein.	De Vouge MW and Mukherjee BB, Oncogene 1992 Jan;7(1):109-19.
4.	Matrix metalloproteinases: discrete elevations in essential hypertension and hypertensive end-stage renal disease.	Friese RS, etal., Clin Exp Hypertens. 2009 Oct;31(7):521-33. doi: 10.3109/10641960802668730.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Overexpression of matrix metalloproteinase-10 and matrix metalloproteinase-3 in human diabetic corneas: a possible mechanism of basement membrane and integrin alterations.	Saghizadeh M, etal., Am J Pathol. 2001 Feb;158(2):723-34.
11.	Cerebrospinal fluid matrix metalloproteinases are elevated in cerebral adrenoleukodystrophy and correlate with MRI severity and neurologic dysfunction.	Thibert KA, etal., PLoS One. 2012;7(11):e50430. doi: 10.1371/journal.pone.0050430. Epub 2012 Nov 21.

Additional References at PubMed

PMID:11869290	PMID:24339723	PMID:31428857

Genomics

Comparative Map Data

Mmp10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	12,974,707 - 12,982,613 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	12,974,707 - 12,982,613 (+)	Ensembl				GRCr8
mRatBN7.2	8	4,689,840 - 4,697,748 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	4,689,840 - 4,697,748 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	8,649,536 - 8,657,457 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	6,947,308 - 6,955,231 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	4,949,505 - 4,957,411 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	5,734,348 - 5,742,243 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	5,734,348 - 5,742,243 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	5,737,196 - 5,745,091 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	4,367,842 - 4,375,737 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	6,249,460 - 6,257,355 (+)	NCBI		Celera
RGSC_v3.1	8	4,367,841 - 4,375,737 (+)	NCBI
Cytogenetic Map	8	q11	NCBI

MMP10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	102,770,502 - 102,780,628 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	102,770,502 - 102,780,628 (-)	Ensembl			hg38	GRCh38
GRCh37	11	102,641,233 - 102,651,359 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	102,146,444 - 102,156,554 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	102,146,443 - 102,156,554	NCBI
Celera	11	99,802,887 - 99,813,014 (-)	NCBI		Celera
Cytogenetic Map	11	q22.2	NCBI
HuRef	11	98,569,206 - 98,579,335 (-)	NCBI		HuRef
CHM1_1	11	102,524,082 - 102,534,205 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	102,774,317 - 102,784,440 (-)	NCBI		T2T-CHM13v2.0

Mmp10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	7,502,343 - 7,510,243 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	7,502,353 - 7,510,241 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	7,502,342 - 7,510,242 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	7,502,352 - 7,510,240 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	7,502,360 - 7,510,240 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	7,490,825 - 7,510,240 (+)	NCBI		MGSCv36	mm8
Celera	9	4,892,709 - 4,900,593 (+)	NCBI		Celera
Cytogenetic Map	9	A1	NCBI
cM Map	9	2.46	NCBI

Mmp10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	5,965,394 - 5,976,382 (-)	Ensembl
ChiLan1.0	NW_004955412	5,965,388 - 5,976,353 (-)	NCBI	ChiLan1.0	ChiLan1.0

MMP10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	103,563,643 - 103,574,074 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	104,651,805 - 104,662,248 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	97,710,819 - 97,721,263 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	101,201,665 - 101,212,103 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	101,201,665 - 101,212,103 (-)	Ensembl			panPan2	panpan1.1

Mmp10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	86,338,808 - 86,348,136 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936551	5,189,189 - 5,196,137 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936551	5,188,395 - 5,197,477 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MMP10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	94,147,995 - 94,158,315 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	94,148,087 - 94,158,097 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	31,719,000 - 31,729,136 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mmp10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624878	107,361 - 117,459 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624878	107,330 - 117,654 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mmp10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	3,740,635 - 3,748,468 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mmp10
21 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	156
Count of miRNA genes:	125
Interacting mature miRNAs:	132
Transcripts:	ENSRNOT00000013119
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	10382540	55382540	Rat
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	32882639	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	10382540	55382540	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	10382540	55382540	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	12964165	57964165	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	12964165	57964165	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	10382540	55382540	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	12964165	57964165	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	1	1	36	20	14	6	4	6	6	62	29	11	13	11	38	8	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M65253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X05083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X64020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013119 ⟹ ENSRNOP00000013118

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	12,974,707 - 12,982,613 (+)	Ensembl
mRatBN7.2 Ensembl	8	4,689,840 - 4,697,748 (+)	Ensembl
Rnor_6.0 Ensembl	8	5,734,348 - 5,742,243 (+)	Ensembl

RefSeq Acc Id:

NM_133514 ⟹ NP_598198

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	12,974,707 - 12,982,613 (+)	NCBI
mRatBN7.2	8	4,689,840 - 4,697,748 (+)	NCBI
Rnor_6.0	8	5,734,348 - 5,742,243 (+)	NCBI
Rnor_5.0	8	5,737,196 - 5,745,091 (+)	NCBI
RGSC_v3.4	8	4,367,842 - 4,375,737 (+)	RGD
Celera	8	6,249,460 - 6,257,355 (+)	RGD

Sequence:

show sequence

GAATTCGGCACGAGTACAGAAGGTAAAGGCTGTCTCTATGGAGCCACTGGCCATCCTGGTGCTG
CTGTGCTTTCCGATCTGCTCAGCATATCCTCTGCATGGGGCAGTGAGACAAGACCACTCAACCA
TGGATCTTGCTCAGCAATACCTAGAAAAATACTACAACTTTAGAAAAAATGAGAAACAATTTTT
CAAAAGAAAGGACAGTAGTCCTGTTGTCAAAAAAATTGAAGAAATGCAGAAGTTCCTTGGGCTG
GAGATGACAGGGAAGCTGGACTCGAACACTGTGGAGATGATGCACAAGCCCCGGTGTGGTGTTC
CCGACGTTGGTGGCTTCAGTACCTTTCCAGGTTCACCCAAATGGAGGAAAAACCACATCTCCTA
CAGGATTGTGAATTATACACTGGATTTACCAAGAGAGAGTGTGGATTCTGCCATTGAGAGAGCT
TTGAAGGTCTGGGAGGAGGTGACCCCACTCACATTCTCCAGGATCTCTGAAGGAGAGGCTGACA
TAATGATCTCCTTTGCAGTTGGAGAACATGGAGACTTTTACCCTTTTGATGGAGTGGGACAGAG
CTTGGCTCATGCCTACCCACCTGGCCCTGGATTTTATGGAGATGCTCACTTCGATGATGATGAG
AAATGGTCACTGGGACCCTCAGGGACCAATTTATTCCTGGTTGCTGCGCATGAACTTGGTCACT
CCCTGGGTCTCTTTCACTCAAACAACAAAGAATCTCTGATGTACCCAGTCTACAGGTTCTCCAC
GAGCCAAGCCAACATTCGCCTTTCTCAGGATGATATAGAGGGCATTCAATCCCTGTATGGAGCC
CGCCCCTCCTCTGATGCCACAGTGGTTCCTGTGCCCTCTGTCTCTCCAAAACCTGAGACCCCAG
TCAAATGTGATCCTGCTTTGTCCTTTGATGCAGTCACCATGCTGAGAGGGGAATTCCTATTCTT
TAAAGACAGGCACTTCTGGCGTAGAACCCAGTGGAATCCCGAGCCTGAATTCCATTTGATTTCA
GCATTTTGGCCCTCTCTTCCTTCAGGCTTAGATGCTGCCTATGAGGCAAATAACAAGGACAGAG
TTCTGATTTTTAAAGGAAGTCAGTTCTGGGCAGTCCGAGGAAATGAAGTCCAAGCAGGTTACCC
AAAGAGGATCCACACTCTTGGCTTTCCTCCCACCGTGAAGAAGATTGATGCAGCTGTTTTTGAA
AAGGAGAAGAAGAAGACGTATTTCTTTGTAGGTGACAAATACTGGAGATTTGATGAGACAAGAC
AGCTTATGGATAAAGGCTTCCCGAGACTGATAACAGATGACTTCCCAGGAATTGAGCCACAAGT
TGATGCTGTGTTACATGCATTTGGGTTTTTTTATTTCTTCTGTGGATCATCACAGTTCGAGTTT
GACCCCAATGCCAGGACGGTGACACACACACTGAAGAGCAACAGCTGGCTGTTGTGCTGATTAT
CATGATGACAAGACATATACAACACTGTAAAATAGTATTTCTCGCCTAATTTATTATGTGTCAT
AATGATGAATTGTTCCTGCATGTGCTGTGGCTCGAGATGAGCCCAGCAGATAGATGTCTTTCTT
AATGAACCACAGAGCATCACCTGAGCACAGAAGTGAAAGCTTCTCGGTACACTAGGTGAGAGGA
TGCATCCCCATGGGTACTTTATTGTTTAATAAAGAACTTTATTTTTGAACCAT

hide sequence

RefSeq Acc Id:

XM_039080709 ⟹ XP_038936637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	12,974,732 - 12,982,612 (+)	NCBI
mRatBN7.2	8	4,689,865 - 4,697,747 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_598198	(Get FASTA)	NCBI Sequence Viewer
	XP_038936637	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42202	(Get FASTA)	NCBI Sequence Viewer
	CAA28739	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013118
GenBank Protein	P07152	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598198 ⟸ NM_133514
- Peptide Label:	precursor
- UniProtKB:	P07152 (UniProtKB/Swiss-Prot), G3V788 (UniProtKB/TrEMBL), A6JN35 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEPLAILVLLCFPICSAYPLHGAVRQDHSTMDLAQQYLEKYYNFRKNEKQFFKRKDSSPVVKKI EEMQKFLGLEMTGKLDSNTVEMMHKPRCGVPDVGGFSTFPGSPKWRKNHISYRIVNYTLDLPRE SVDSAIERALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGVGQSLAHAYPPGPGFY GDAHFDDDEKWSLGPSGTNLFLVAAHELGHSLGLFHSNNKESLMYPVYRFSTSQANIRLSQDDI EGIQSLYGARPSSDATVVPVPSVSPKPETPVKCDPALSFDAVTMLRGEFLFFKDRHFWRRTQWN PEPEFHLISAFWPSLPSGLDAAYEANNKDRVLIFKGSQFWAVRGNEVQAGYPKRIHTLGFPPTV KKIDAAVFEKEKKKTYFFVGDKYWRFDETRQLMDKGFPRLITDDFPGIEPQVDAVLHAFGFFYF FCGSSQFEFDPNARTVTHTLKSNSWLLC hide sequence

Ensembl Acc Id:

ENSRNOP00000013118 ⟸ ENSRNOT00000013119

RefSeq Acc Id:	XP_038936637 ⟸ XM_039080709
- Peptide Label:	isoform X1
- UniProtKB:	P07152 (UniProtKB/Swiss-Prot)

Protein Domains

Peptidase metallopeptidase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P07152-F1-model_v2	AlphaFold	P07152	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695733

Promoter ID:

EPDNEW_R6258

Type:

single initiation site

Name:

Mmp10_1

Description:

matrix metallopeptidase 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	5,734,333 - 5,734,393	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620192	AgrOrtholog
BioCyc Gene	G2FUF-31787	BioCyc
Ensembl Genes	ENSRNOG00000032832	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013119	ENTREZGENE
Gene3D-CATH	2.110.10.10	UniProtKB/Swiss-Prot
	3.40.390.10	UniProtKB/Swiss-Prot
InterPro	Hemopexin-like_dom	UniProtKB/Swiss-Prot
	Hemopexin-like_dom_sf	UniProtKB/Swiss-Prot
	Hemopexin-like_repeat	UniProtKB/Swiss-Prot
	Hemopexin_CS	UniProtKB/Swiss-Prot
	M10A_MMP	UniProtKB/Swiss-Prot
	MetalloPept_cat_dom_sf	UniProtKB/Swiss-Prot
	Pept_M10_metallopeptidase	UniProtKB/Swiss-Prot
	Pept_M10A	UniProtKB/Swiss-Prot
	Pept_M10A_Zn_BS	UniProtKB/Swiss-Prot
	Peptidase_Metallo	UniProtKB/Swiss-Prot
	Peptidoglycan-bd-like	UniProtKB/Swiss-Prot
	PGBD-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:117061	UniProtKB/Swiss-Prot
NCBI Gene	117061	ENTREZGENE
PANTHER	MATRIX METALLOPROTEINASE	UniProtKB/Swiss-Prot
	STROMELYSIN-2	UniProtKB/Swiss-Prot
Pfam	Hemopexin	UniProtKB/Swiss-Prot
	Peptidase_M10	UniProtKB/Swiss-Prot
	PG_binding_1	UniProtKB/Swiss-Prot
PhenoGen	Mmp10	PhenoGen
PIRSF	Peptidase_M10A_matrix	UniProtKB/Swiss-Prot
PRINTS	MATRIXIN	UniProtKB/Swiss-Prot
PROSITE	CYSTEINE_SWITCH	UniProtKB/Swiss-Prot
	HEMOPEXIN	UniProtKB/Swiss-Prot
	HEMOPEXIN_2	UniProtKB/Swiss-Prot
	ZINC_PROTEASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000032832	RatGTEx
SMART	SM00120	UniProtKB/Swiss-Prot
	ZnMc	UniProtKB/Swiss-Prot
Superfamily-SCOP	Metalloproteases ('zincins'), catalytic domain	UniProtKB/Swiss-Prot
	SSF47090	UniProtKB/Swiss-Prot
	SSF50923	UniProtKB/Swiss-Prot
UniProt	A6JN35	ENTREZGENE, UniProtKB/TrEMBL
	G3V788	ENTREZGENE, UniProtKB/TrEMBL
	MMP10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-03-04	Mmp10	matrix metallopeptidase 10	Mmp10	matrix metallopeptidase 10 (stromelysin 2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-02-27	Mmp10	matrix metallopeptidase 10 (stromelysin 2)	Mmp10	matrix metallopeptidase 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Mmp10	matrix metallopeptidase 10		matrix metalloproteinase 10	Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Mmp10	matrix metalloproteinase 10			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is induced by oncogenes and epidermal growth factor (EGF)	728974

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD