Symbol:
Ywhag
Name:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
RGD ID:
62002
Description:
Enables receptor tyrosine kinase binding activity. Involved in cellular response to insulin stimulus. Located in vesicle. Is active in presynapse. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 56. Orthologous to human YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; interleukin-3 signaling pathway; mTOR signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
14-3-3 protein gamma; 14-3-3 protein gamma-subtype; 14-3-3G; 3-monooxygenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein gamma; tryosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; tryosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, gamma polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
YWHAH (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta) HGNC
OrthoDB
Homo sapiens (human):
RFC3 (replication factor C subunit 3) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
YWHAG (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ywhag2 (3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ywhag1 (3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ywhag
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 26,381,106 - 26,409,466 (+) NCBI GRCr8 mRatBN7.2 12 20,744,500 - 20,772,828 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 20,744,535 - 20,772,827 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 21,886,692 - 21,914,903 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 22,499,081 - 22,527,298 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 21,564,574 - 21,592,894 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 23,789,547 - 23,817,884 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 23,789,638 - 23,817,883 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 25,788,140 - 25,816,532 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 21,859,804 - 21,888,050 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 21,847,105 - 21,875,295 (+) NCBI Celera 12 22,507,939 - 22,536,185 (+) NCBI Celera RH 3.4 Map 12 300.5 RGD Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ywhag Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YWHAG mRNA] CTD PMID:31150632 Ywhag Rat (-)-epigallocatechin 3-gallate multiple interactions ISO YWHAG (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of YWHAG mRNA CTD PMID:22079256 Ywhag Rat (1->4)-beta-D-glucan multiple interactions ISO Ywhag (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of YWHAG mRNA CTD PMID:36331819 Ywhag Rat 1,2-dimethylhydrazine multiple interactions ISO Ywhag (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of YWHAG mRNA CTD PMID:22206623 Ywhag Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Ywhag (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:15329391 Ywhag Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of YWHAG mRNA CTD PMID:25380136 Ywhag Rat 17beta-estradiol affects expression ISO YWHAG (Homo sapiens) 6480464 Estradiol affects the expression of YWHAG mRNA CTD PMID:22574217 Ywhag Rat 17beta-estradiol increases expression ISO YWHAG (Homo sapiens) 6480464 Estradiol results in increased expression of YWHAG mRNA CTD PMID:31614463 Ywhag Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ywhag (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of YWHAG mRNA CTD PMID:21570461 Ywhag Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of YWHAG mRNA CTD PMID:33387578 Ywhag Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of YWHAG mRNA CTD PMID:26232522 and PMID:34747641 Ywhag Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Ywhag Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of YWHAG mRNA CTD PMID:21346803 Ywhag Rat 2,6-dimethoxyphenol multiple interactions ISO YWHAG (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Ywhag Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of YWHAG mRNA CTD PMID:21346803 Ywhag Rat 2-hydroxypropanoic acid increases expression ISO YWHAG (Homo sapiens) 6480464 Lactic Acid results in increased expression of YWHAG mRNA CTD PMID:30851411 Ywhag Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO YWHAG (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of YWHAG protein CTD PMID:31675489 Ywhag Rat 3,4-methylenedioxymethamphetamine increases expression ISO Ywhag (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of YWHAG mRNA CTD PMID:20188158 Ywhag Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of YWHAG protein CTD PMID:34915118 Ywhag Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of YWHAG mRNA CTD PMID:25380136 Ywhag Rat 4,4'-diaminodiphenylmethane affects expression ISO Ywhag (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of YWHAG mRNA CTD PMID:18648102 Ywhag Rat 4,4'-sulfonyldiphenol increases expression ISO Ywhag (Mus musculus) 6480464 bisphenol S results in increased expression of YWHAG mRNA CTD PMID:39298647 Ywhag Rat 4,4'-sulfonyldiphenol increases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol S results in increased expression of YWHAG protein CTD PMID:34186270 Ywhag Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of YWHAG mRNA CTD PMID:36041667 Ywhag Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of YWHAG mRNA CTD PMID:21346803 Ywhag Rat 4-nitrophenol decreases expression ISO Ywhag (Mus musculus) 6480464 4-nitrophenol results in decreased expression of YWHAG mRNA CTD PMID:34673133 Ywhag Rat 4-vinylcyclohexene dioxide affects expression ISO Ywhag (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of YWHAG mRNA CTD PMID:20829426 Ywhag Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of YWHAG mRNA CTD PMID:30047161 Ywhag Rat 7,12-dimethyltetraphene decreases expression ISO Ywhag (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Ywhag Rat acrylamide increases expression ISO YWHAG (Homo sapiens) 6480464 Acrylamide results in increased expression of YWHAG mRNA CTD PMID:32763439 Ywhag Rat aflatoxin B1 decreases expression ISO Ywhag (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of YWHAG mRNA CTD PMID:19770486 Ywhag Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of YWHAG mRNA CTD PMID:33354967 Ywhag Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of YWHAG mRNA CTD PMID:38685447 Ywhag Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of YWHAG mRNA CTD PMID:30047161 Ywhag Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of YWHAG mRNA CTD PMID:16483693 Ywhag Rat aristolochic acid A increases expression ISO YWHAG (Homo sapiens) 6480464 aristolochic acid I results in increased expression of YWHAG protein CTD PMID:33212167 Ywhag Rat arsane affects methylation ISO YWHAG (Homo sapiens) 6480464 Arsenic affects the methylation of YWHAG gene CTD PMID:25304211 Ywhag Rat arsane multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat arsenic atom affects methylation ISO YWHAG (Homo sapiens) 6480464 Arsenic affects the methylation of YWHAG gene CTD PMID:25304211 Ywhag Rat arsenic atom multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat arsenous acid decreases expression ISO YWHAG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of YWHAG protein CTD PMID:19364129 Ywhag Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat benzo[a]pyrene decreases expression ISO Ywhag (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of YWHAG mRNA CTD PMID:19770486 Ywhag Rat benzo[a]pyrene increases methylation ISO YWHAG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of YWHAG promoter CTD PMID:27901495 Ywhag Rat benzo[a]pyrene affects methylation ISO YWHAG (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of YWHAG 3' UTR CTD PMID:27901495 Ywhag Rat benzo[a]pyrene decreases expression ISO YWHAG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of YWHAG mRNA CTD PMID:31255691 Ywhag Rat benzo[a]pyrene increases expression ISO Ywhag (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of YWHAG mRNA CTD PMID:22228805 Ywhag Rat benzo[a]pyrene multiple interactions ISO Ywhag (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of YWHAG mRNA] CTD PMID:22228805 Ywhag Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of YWHAG mRNA CTD PMID:21839799 Ywhag Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ywhag (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of YWHAG mRNA CTD PMID:34319233 Ywhag Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of YWHAG mRNA CTD PMID:25181051 Ywhag Rat bisphenol A increases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol A results in increased expression of YWHAG protein CTD PMID:37567409 Ywhag Rat bisphenol A decreases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol A results in decreased expression of YWHAG protein CTD PMID:34186270 Ywhag Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of YWHAG mRNA CTD PMID:36041667 Ywhag Rat bisphenol A decreases methylation ISO Ywhag (Mus musculus) 6480464 bisphenol A results in decreased methylation of YWHAG promoter CTD PMID:27312807 Ywhag Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of YWHAG gene CTD PMID:28505145 Ywhag Rat bisphenol AF increases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol AF results in increased expression of YWHAG protein CTD PMID:34186270 Ywhag Rat Bisphenol B increases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol B results in increased expression of YWHAG protein CTD PMID:34186270 Ywhag Rat bisphenol F increases expression ISO Ywhag (Mus musculus) 6480464 bisphenol F results in increased expression of YWHAG mRNA CTD PMID:38685157 Ywhag Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of YWHAG mRNA CTD PMID:36041667 Ywhag Rat bisphenol F increases expression ISO YWHAG (Homo sapiens) 6480464 bisphenol F results in increased expression of YWHAG protein CTD PMID:34186270 Ywhag Rat cadmium dichloride increases expression ISO YWHAG (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of YWHAG mRNA and Cadmium Chloride results in increased expression of YWHAG protein CTD PMID:24527689 and PMID:38568856 Ywhag Rat caffeine increases expression ISO YWHAG (Homo sapiens) 6480464 Caffeine results in increased expression of YWHAG protein CTD PMID:31195006 Ywhag Rat caffeine increases phosphorylation ISO YWHAG (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of YWHAG protein CTD PMID:35688186 Ywhag Rat carbon nanotube affects expression ISO YWHAG (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of YWHAG protein CTD PMID:22001959 Ywhag Rat carbon nanotube increases expression ISO Ywhag (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ywhag Rat casticin decreases expression ISO Ywhag (Mus musculus) 6480464 casticin results in decreased expression of YWHAG mRNA CTD PMID:28444820 Ywhag Rat chromium(6+) affects expression ISO Ywhag (Mus musculus) 6480464 chromium hexavalent ion affects the expression of YWHAG mRNA CTD PMID:28472532 Ywhag Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of YWHAG mRNA CTD PMID:17602206 Ywhag Rat copper atom decreases expression ISO Ywhag (Mus musculus) 6480464 Copper results in decreased expression of YWHAG protein CTD PMID:23882024 Ywhag Rat copper atom multiple interactions ISO YWHAG (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of YWHAG mRNA CTD PMID:30911355 Ywhag Rat copper(0) decreases expression ISO Ywhag (Mus musculus) 6480464 Copper results in decreased expression of YWHAG protein CTD PMID:23882024 Ywhag Rat copper(0) multiple interactions ISO YWHAG (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of YWHAG mRNA CTD PMID:30911355 Ywhag Rat copper(II) sulfate increases expression ISO YWHAG (Homo sapiens) 6480464 Copper Sulfate results in increased expression of YWHAG mRNA CTD PMID:19549813 Ywhag Rat CU-O LINKAGE decreases expression ISO Ywhag (Mus musculus) 6480464 cupric oxide analog results in decreased expression of YWHAG protein CTD PMID:23882024 Ywhag Rat diarsenic trioxide decreases expression ISO YWHAG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of YWHAG protein CTD PMID:19364129 Ywhag Rat dibenzo[a,l]pyrene decreases expression ISO YWHAG (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of YWHAG mRNA CTD PMID:31255691 Ywhag Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of YWHAG mRNA CTD PMID:18636392 Ywhag Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of YWHAG mRNA CTD PMID:18636392 Ywhag Rat dioxygen increases expression ISO Ywhag (Mus musculus) 6480464 Oxygen deficiency results in increased expression of YWHAG mRNA CTD PMID:24205000 Ywhag Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of YWHAG protein CTD PMID:30636491 Ywhag Rat doxorubicin multiple interactions EXP 6480464 Quercetin promotes the reaction [Doxorubicin results in increased expression of YWHAG protein] more ... CTD PMID:30636491 Ywhag Rat enniatin decreases expression EXP 6480464 enniatins results in decreased expression of YWHAG mRNA CTD PMID:27163883 Ywhag Rat epoxiconazole decreases expression ISO Ywhag (Mus musculus) 6480464 epoxiconazole results in decreased expression of YWHAG mRNA CTD PMID:35436446 Ywhag Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of YWHAG mRNA CTD PMID:15353170 Ywhag Rat Evodiamine increases expression ISO YWHAG (Homo sapiens) 6480464 evodiamine results in increased expression of YWHAG mRNA CTD PMID:38878560 Ywhag Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of YWHAG mRNA CTD PMID:24136188 Ywhag Rat folic acid decreases expression ISO Ywhag (Mus musculus) 6480464 Folic Acid results in decreased expression of YWHAG mRNA CTD PMID:25629700 Ywhag Rat folic acid multiple interactions ISO Ywhag (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of YWHAG mRNA CTD PMID:22206623 Ywhag Rat FR900359 increases phosphorylation ISO YWHAG (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of YWHAG protein CTD PMID:37730182 Ywhag Rat fumagillin multiple interactions ISO YWHAG (Homo sapiens) 6480464 [fumagillin results in decreased activity of [METAP1 protein co-treated with METAP2 protein]] which results in decreased metabolism of YWHAG protein CTD PMID:14534293 Ywhag Rat fumonisin B1 increases expression ISO Ywhag (Mus musculus) 6480464 fumonisin B1 results in increased expression of YWHAG mRNA CTD PMID:16221962 Ywhag Rat furfural multiple interactions ISO YWHAG (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of YWHAG protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of YWHAG protein CTD PMID:38598786 Ywhag Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of YWHAG mRNA CTD PMID:22061828 Ywhag Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of YWHAG mRNA CTD PMID:15345336 Ywhag Rat gold atom multiple interactions ISO Ywhag (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of YWHAG mRNA CTD PMID:19695318 Ywhag Rat gold(0) multiple interactions ISO Ywhag (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of YWHAG mRNA CTD PMID:19695318 Ywhag Rat hydrogen cyanide decreases expression ISO Ywhag (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of YWHAG mRNA CTD PMID:33914522 Ywhag Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of YWHAG mRNA CTD PMID:30303030 Ywhag Rat ivermectin decreases expression ISO YWHAG (Homo sapiens) 6480464 Ivermectin results in decreased expression of YWHAG protein CTD PMID:32959892 Ywhag Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat L-glutamic acid multiple interactions ISO Ywhag (Mus musculus) 6480464 YWHAG protein affects the reaction [Glutamic Acid results in increased activity of TRPM4 protein] CTD PMID:25047048 Ywhag Rat lead(0) affects expression ISO YWHAG (Homo sapiens) 6480464 Lead affects the expression of YWHAG mRNA CTD PMID:28903495 Ywhag Rat lipopolysaccharide multiple interactions ISO YWHAG (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of YWHAG mRNA CTD PMID:35877022 Ywhag Rat manganese atom multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat manganese(0) multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat manganese(II) chloride multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of YWHAG mRNA CTD PMID:16507785 Ywhag Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of YWHAG mRNA CTD PMID:30047161 Ywhag Rat microcystin RR decreases expression ISO YWHAG (Homo sapiens) 6480464 microcystin RR results in decreased expression of YWHAG protein CTD PMID:19111056 Ywhag Rat microcystin-LR increases expression ISO Ywhag (Mus musculus) 6480464 cyanoginosin LR results in increased expression of YWHAG mRNA CTD PMID:17654400 Ywhag Rat N-methyl-4-phenylpyridinium decreases expression ISO Ywhag (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of YWHAG protein CTD PMID:26558463 Ywhag Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of YWHAG mRNA CTD PMID:17602206 Ywhag Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of YWHAG protein CTD PMID:19716841 Ywhag Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of YWHAG mRNA CTD PMID:24136188 Ywhag Rat nitrates multiple interactions ISO Ywhag (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of YWHAG mRNA CTD PMID:35964746 Ywhag Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of YWHAG mRNA CTD PMID:18636392 Ywhag Rat paracetamol affects expression ISO Ywhag (Mus musculus) 6480464 Acetaminophen affects the expression of YWHAG mRNA CTD PMID:17562736 Ywhag Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of YWHAG mRNA CTD PMID:33387578 Ywhag Rat paracetamol increases expression ISO YWHAG (Homo sapiens) 6480464 Acetaminophen results in increased expression of YWHAG mRNA CTD PMID:21420995 Ywhag Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Ywhag Rat pentachlorophenol increases expression ISO Ywhag (Mus musculus) 6480464 Pentachlorophenol results in increased expression of YWHAG mRNA CTD PMID:23892564 Ywhag Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ywhag (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of YWHAG mRNA CTD PMID:36331819 Ywhag Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of YWHAG mRNA CTD PMID:19162173 Ywhag Rat pirinixic acid increases expression ISO Ywhag (Mus musculus) 6480464 pirinixic acid results in increased expression of YWHAG mRNA CTD PMID:16221962 and PMID:18301758 Ywhag Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of YWHAG mRNA CTD PMID:19162173 Ywhag Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat potassium chromate increases expression ISO YWHAG (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of YWHAG mRNA CTD PMID:22079256 Ywhag Rat potassium chromate multiple interactions ISO YWHAG (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of YWHAG mRNA CTD PMID:22079256 Ywhag Rat propiconazole increases expression ISO Ywhag (Mus musculus) 6480464 propiconazole results in increased expression of YWHAG mRNA CTD PMID:21278054 Ywhag Rat prostaglandin F2alpha increases expression EXP 6480464 Dinoprost results in increased expression of YWHAG mRNA CTD PMID:11517196 Ywhag Rat quercetin multiple interactions EXP 6480464 Quercetin promotes the reaction [Doxorubicin results in increased expression of YWHAG protein] more ... CTD PMID:30636491 Ywhag Rat rac-lactic acid increases expression ISO YWHAG (Homo sapiens) 6480464 Lactic Acid results in increased expression of YWHAG mRNA CTD PMID:30851411 Ywhag Rat resveratrol decreases expression ISO Ywhag (Mus musculus) 6480464 resveratrol results in decreased expression of YWHAG protein CTD PMID:25505154 Ywhag Rat rotenone decreases response to substance ISO YWHAG (Homo sapiens) 6480464 YWHAG protein results in decreased susceptibility to Rotenone CTD PMID:22490660 Ywhag Rat silicon dioxide affects secretion ISO YWHAG (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of YWHAG protein CTD PMID:25895662 Ywhag Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of YWHAG protein CTD PMID:29459688 Ywhag Rat sodium arsenite multiple interactions ISO YWHAG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of YWHAG mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of YWHAG mRNA CTD PMID:39836092 Ywhag Rat sodium arsenite increases expression ISO YWHAG (Homo sapiens) 6480464 sodium arsenite results in increased expression of YWHAG mRNA CTD PMID:38568856 Ywhag Rat sodium chloride multiple interactions ISO YWHAG (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of YWHAG protein more ... CTD PMID:38598786 Ywhag Rat sodium fluoride increases expression ISO Ywhag (Mus musculus) 6480464 Sodium Fluoride results in increased expression of YWHAG protein CTD PMID:27548804 Ywhag Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of YWHAG mRNA CTD PMID:30047161 Ywhag Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of YWHAG protein CTD PMID:26141394 Ywhag Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YWHAG mRNA] CTD PMID:31150632 Ywhag Rat tetrachloromethane increases expression ISO Ywhag (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of YWHAG mRNA CTD PMID:31919559 Ywhag Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of YWHAG mRNA CTD PMID:31150632 Ywhag Rat thapsigargin decreases expression ISO YWHAG (Homo sapiens) 6480464 Thapsigargin results in decreased expression of YWHAG mRNA CTD PMID:22378314 Ywhag Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of YWHAG mRNA CTD PMID:19483382 Ywhag Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of YWHAG mRNA CTD PMID:23411599 and PMID:34492290 Ywhag Rat titanium dioxide increases methylation ISO Ywhag (Mus musculus) 6480464 titanium dioxide results in increased methylation of YWHAG gene and titanium dioxide results in increased methylation of YWHAG promoter CTD PMID:35295148 Ywhag Rat titanium dioxide decreases methylation ISO Ywhag (Mus musculus) 6480464 titanium dioxide results in decreased methylation of YWHAG enhancer and titanium dioxide results in decreased methylation of YWHAG gene CTD PMID:35295148 Ywhag Rat triphenyl phosphate affects expression ISO YWHAG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of YWHAG mRNA CTD PMID:37042841 Ywhag Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of YWHAG mRNA CTD PMID:23639586 Ywhag Rat tunicamycin decreases expression ISO YWHAG (Homo sapiens) 6480464 Tunicamycin results in decreased expression of YWHAG mRNA CTD PMID:22378314 Ywhag Rat valproic acid affects expression ISO Ywhag (Mus musculus) 6480464 Valproic Acid affects the expression of YWHAG mRNA CTD PMID:17292431
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-nitrophenol (ISO) 4-vinylcyclohexene dioxide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzbromarone (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) casticin (ISO) chromium(6+) (ISO) clofibrate (EXP) clofibric acid (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dichlorine (EXP) dioxygen (ISO) doxorubicin (EXP) enniatin (EXP) epoxiconazole (ISO) ethanol (EXP) Evodiamine (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fumagillin (ISO) fumonisin B1 (ISO) furfural (ISO) gentamycin (EXP) glutathione (EXP) gold atom (ISO) gold(0) (ISO) hydrogen cyanide (ISO) isoprenaline (EXP) ivermectin (ISO) L-ethionine (EXP) L-glutamic acid (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (EXP) methimazole (EXP) microcystin RR (ISO) microcystin-LR (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nitrates (ISO) omeprazole (EXP) ozone (EXP) paracetamol (EXP,ISO) PCB138 (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) propiconazole (ISO) prostaglandin F2alpha (EXP) quercetin (EXP) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (EXP) tunicamycin (ISO) valproic acid (ISO)
Biological Process
cellular response to glucose starvation (IEA,ISO) cellular response to insulin stimulus (IDA) negative regulation of TORC1 signaling (IEA,ISO) positive regulation of cell-cell adhesion (IEA,ISO,ISS) positive regulation of T cell activation (IEA,ISO) positive regulation of T cell mediated immune response to tumor cell (IEA,ISO) protein localization (IBA) protein targeting (ISO) regulation of neuron differentiation (IEA,ISO,ISS) regulation of protein localization (IEA,ISO,ISS) regulation of synaptic plasticity (IEA,ISO,ISS) signal transduction (IBA)
Molecular Function
actin binding (ISS) enzyme regulator activity (TAS) identical protein binding (IEA,ISO) insulin-like growth factor receptor binding (IEA,ISO,ISS) phosphorylation-dependent protein binding (IEA,ISO,ISS) protein binding (IPI,ISO) protein domain specific binding (ISO) protein kinase C binding (IBA,IEA,ISO,ISS) protein sequestering activity (IEA,ISO,ISS) receptor tyrosine kinase binding (IPI)
1.
Diagnostic value of surrogate CSF biomarkers for Creutzfeldt-Jakob disease in the era of RT-QuIC.
Abu-Rumeileh S, etal., J Neurol. 2019 Dec;266(12):3136-3143. doi: 10.1007/s00415-019-09537-0. Epub 2019 Sep 20.
2.
Inhibition of calcium/calmodulin-dependent protein kinase kinase by protein 14-3-3.
Davare MA, etal., J Biol Chem. 2004 Dec 10;279(50):52191-9. Epub 2004 Oct 6.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
14-3-3 Proteins directly regulate Ca(2+)/calmodulin-dependent protein kinase kinase alpha through phosphorylation-dependent multisite binding.
Ichimura T, etal., FEBS Lett. 2008 Mar 5;582(5):661-5. doi: 10.1016/j.febslet.2008.01.037. Epub 2008 Jan 31.
5.
Cerebrospinal fluid neurofilament light in suspected sporadic Creutzfeldt-Jakob disease.
Kanata E, etal., J Clin Neurosci. 2019 Feb;60:124-127. doi: 10.1016/j.jocn.2018.09.031. Epub 2018 Oct 9.
6.
AS160 phosphotyrosine-binding domain constructs inhibit insulin-stimulated GLUT4 vesicle fusion with the plasma membrane.
Koumanov F, etal., J Biol Chem. 2011 May 13;286(19):16574-82. doi: 10.1074/jbc.M111.226092. Epub 2011 Mar 17.
7.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.
Modulation of inactivation properties of CaV2.2 channels by 14-3-3 proteins.
Li Y, etal., Neuron. 2006 Sep 21;51(6):755-71. doi: 10.1016/j.neuron.2006.08.014.
9.
Subcellular localisation of 14-3-3 isoforms in rat brain using specific antibodies.
Martin H, etal., J Neurochem. 1994 Dec;63(6):2259-65.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Parkinson-related LRRK2 mutation R1441C/G/H impairs PKA phosphorylation of LRRK2 and disrupts its interaction with 14-3-3.
Muda K, etal., Proc Natl Acad Sci U S A. 2014 Jan 7;111(1):E34-43. doi: 10.1073/pnas.1312701111. Epub 2013 Dec 18.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Neurofilaments in blood and CSF for diagnosis and prediction of onset in Creutzfeldt-Jakob disease.
Steinacker P, etal., Sci Rep. 2016 Dec 8;6:38737. doi: 10.1038/srep38737.
18.
14-3-3 gamma associates with muscle specific kinase and regulates synaptic gene transcription at vertebrate neuromuscular synapse.
Strochlic L, etal., Proc Natl Acad Sci U S A. 2004 Dec 28;101(52):18189-94. Epub 2004 Dec 16.
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.
Molecular cloning of rat cDNAs for beta and gamma subtypes of 14-3-3 protein and developmental changes in expression of their mRNAs in the nervous system.
Watanabe M, etal., Brain Res Mol Brain Res 1993 Jan;17(1-2):135-46.
21.
Molecular cloning of rat cDNAs for the zeta and theta subtypes of 14-3-3 protein and differential distributions of their mRNAs in the brain.
Watanabe M, etal., Brain Res Mol Brain Res 1994 Aug;25(1-2):113-21.
Ywhag Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 26,381,106 - 26,409,466 (+) NCBI GRCr8 mRatBN7.2 12 20,744,500 - 20,772,828 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 20,744,535 - 20,772,827 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 21,886,692 - 21,914,903 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 22,499,081 - 22,527,298 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 21,564,574 - 21,592,894 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 23,789,547 - 23,817,884 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 23,789,638 - 23,817,883 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 25,788,140 - 25,816,532 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 21,859,804 - 21,888,050 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 21,847,105 - 21,875,295 (+) NCBI Celera 12 22,507,939 - 22,536,185 (+) NCBI Celera RH 3.4 Map 12 300.5 RGD Cytogenetic Map 12 q12 NCBI
YWHAG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 76,326,799 - 76,358,991 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 76,326,799 - 76,358,991 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 75,956,116 - 75,988,308 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 75,794,052 - 75,826,252 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 75,600,767 - 75,632,967 NCBI Celera 7 70,824,607 - 70,856,862 (-) NCBI Celera Cytogenetic Map 7 q11.23 NCBI HuRef 7 71,042,455 - 71,074,829 (-) NCBI HuRef CHM1_1 7 75,886,202 - 75,918,463 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 77,614,271 - 77,646,485 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 75,289,172 - 75,321,406 (-) NCBI
Ywhag Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 135,937,233 - 135,963,495 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 135,937,263 - 135,963,470 (-) Ensembl GRCm39 Ensembl GRCm38 5 135,908,379 - 135,934,641 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 135,908,409 - 135,934,616 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 136,384,249 - 136,410,511 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 136,193,036 - 136,219,151 (-) NCBI MGSCv36 mm8 Celera 5 132,916,950 - 132,946,032 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 75.53 NCBI
Ywhag Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 14,939,084 - 14,970,248 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 14,939,130 - 14,970,248 (-) NCBI ChiLan1.0 ChiLan1.0
YWHAG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 93,594,488 - 93,627,035 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 141,859,428 - 141,891,673 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 67,661,589 - 67,693,814 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 82,773,779 - 82,777,252 (-) NCBI panpan1.1 PanPan1.1 panPan2
YWHAG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 7,504,834 - 7,548,097 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 7,507,608 - 7,532,409 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 9,200,437 - 9,228,221 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 7,325,329 - 7,353,135 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 7,325,457 - 7,353,171 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 7,294,343 - 7,322,128 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 7,257,314 - 7,285,076 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 7,420,808 - 7,448,168 (-) NCBI UU_Cfam_GSD_1.0
Ywhag Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 131,940,360 - 131,974,428 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936543 2,061,794 - 2,096,525 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936543 2,062,137 - 2,096,207 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
YWHAG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 9,994,836 - 10,023,289 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 9,994,802 - 10,023,296 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 9,882,655 - 9,911,118 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YWHAG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 10,462,984 - 10,494,500 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 10,462,859 - 10,494,457 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 5,923,909 - 5,955,125 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ywhag
.
Predicted Target Of
Count of predictions: 369 Count of miRNA genes: 219 Interacting mature miRNAs: 260 Transcripts: ENSRNOT00000001954 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 631521 Pia12 Pristane induced arthritis QTL 12 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 20259417 23672083 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
BE098443
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,771,063 - 20,771,237 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,816,120 - 23,816,293 NCBI Rnor6.0 Rnor_5.0 12 25,814,768 - 25,814,941 UniSTS Rnor5.0 RGSC_v3.4 12 21,886,286 - 21,886,459 UniSTS RGSC3.4 Celera 12 22,534,421 - 22,534,594 UniSTS RH 3.4 Map 12 301.7 UniSTS Cytogenetic Map 12 q12 UniSTS
RH142408
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,771,298 - 20,771,491 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,816,355 - 23,816,547 NCBI Rnor6.0 Rnor_5.0 12 25,815,003 - 25,815,195 UniSTS Rnor5.0 RGSC_v3.4 12 21,886,521 - 21,886,713 UniSTS RGSC3.4 Celera 12 22,534,656 - 22,534,848 UniSTS RH 3.4 Map 12 300.5 UniSTS Cytogenetic Map 12 q12 UniSTS
RH137270
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,771,291 - 20,771,490 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,816,348 - 23,816,546 NCBI Rnor6.0 Rnor_5.0 12 25,814,996 - 25,815,194 UniSTS Rnor5.0 RGSC_v3.4 12 21,886,514 - 21,886,712 UniSTS RGSC3.4 Celera 12 22,534,649 - 22,534,847 UniSTS RH 3.4 Map 12 298.6 UniSTS Cytogenetic Map 12 q12 UniSTS
BF417900
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,764,953 - 20,765,155 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,810,010 - 23,810,211 NCBI Rnor6.0 Rnor_5.0 12 25,808,658 - 25,808,859 UniSTS Rnor5.0 RGSC_v3.4 12 21,880,176 - 21,880,377 UniSTS RGSC3.4 Celera 12 22,528,311 - 22,528,512 UniSTS RH 3.4 Map 12 300.61 UniSTS Cytogenetic Map 12 q12 UniSTS
SSC3D06
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,772,547 - 20,772,744 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,817,604 - 23,817,800 NCBI Rnor6.0 Rnor_5.0 12 25,816,252 - 25,816,448 UniSTS Rnor5.0 RGSC_v3.4 12 21,887,770 - 21,887,966 UniSTS RGSC3.4 Celera 12 22,535,905 - 22,536,101 UniSTS Cytogenetic Map 12 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001954 ⟹ ENSRNOP00000001954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 20,744,535 - 20,772,827 (+) Ensembl Rnor_6.0 Ensembl 12 23,789,638 - 23,817,883 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084730 ⟹ ENSRNOP00000069671
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 20,744,567 - 20,772,825 (+) Ensembl Rnor_6.0 Ensembl 12 23,789,675 - 23,817,865 (+) Ensembl
RefSeq Acc Id:
NM_019376 ⟹ NP_062249
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 26,381,219 - 26,409,466 (+) NCBI mRatBN7.2 12 20,744,580 - 20,772,828 (+) NCBI Rnor_6.0 12 23,789,638 - 23,817,884 (+) NCBI Rnor_5.0 12 25,788,140 - 25,816,532 (+) NCBI RGSC_v3.4 12 21,859,804 - 21,888,050 (+) RGD Celera 12 22,507,939 - 22,536,185 (+) RGD
Sequence:
CCTTCTCGTCCTCGCCTTAGCAGCTTGCTTCGTGGGTCGGTCCTTCCGACACACGAGCTCCAAGCCGCTCCTCTCTTTTCCTAAAGCCCTTCAAGGCAGTCTTCGGTTTCCTTCTTTCCAGCCGACCC
hide sequence
RefSeq Acc Id:
XM_006249184 ⟹ XP_006249246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 26,381,106 - 26,409,466 (+) NCBI mRatBN7.2 12 20,744,500 - 20,772,828 (+) NCBI Rnor_6.0 12 23,789,547 - 23,817,884 (+) NCBI Rnor_5.0 12 25,788,140 - 25,816,532 (+) NCBI
Sequence:
GGGCGGGACCGCAGGGGGTTGTCCGCCCGCGGCACGCATTGGAGCCGCAGCCTCCTTGCGCCGGGTCCCGCGGTCGCAGCTCGTGCCGCCTCCTTCTCGTCCTCGCCTTAGCAGCTTGCTTCGTGGGT
hide sequence
RefSeq Acc Id:
NP_062249 ⟸ NM_019376
- UniProtKB:
A0JPM0 (UniProtKB/Swiss-Prot), P61983 (UniProtKB/Swiss-Prot), A6J0A1 (UniProtKB/TrEMBL), A0A8L2R1A5 (UniProtKB/TrEMBL)
- Sequence:
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKG
hide sequence
RefSeq Acc Id:
XP_006249246 ⟸ XM_006249184
- Peptide Label:
isoform X1
- UniProtKB:
A0JPM0 (UniProtKB/Swiss-Prot), P61983 (UniProtKB/Swiss-Prot), A6J0A1 (UniProtKB/TrEMBL), A0A8L2R1A5 (UniProtKB/TrEMBL)
- Sequence:
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKG
hide sequence
Ensembl Acc Id:
ENSRNOP00000069671 ⟸ ENSRNOT00000084730
Ensembl Acc Id:
ENSRNOP00000001954 ⟸ ENSRNOT00000001954
RGD ID: 13698545 Promoter ID: EPDNEW_R9068 Type: initiation region Name: Ywhag_1 Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activationprotein, gamma SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 23,789,595 - 23,789,655 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-12-11
Ywhag
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
Ywhag
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-27
Ywhag
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Ywhag
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide
Name updated
1299863 APPROVED
2002-06-10
Ywhag
tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide
Name updated
70584 APPROVED
2002-01-14
Ywhag
tryosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide
correction to spelling of name
68926 APPROVED
2001-10-22
Ywhag
tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein, gamma
Name updated
68913 WITHDRAWN
2001-10-22
Ywhag
tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein, gamma polypeptide
Name updated
68913 APPROVED
2001-07-23
Ywhag
tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein, gamma
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
2001-07-23
Ywhag
3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide
Name withdrawn
67952 WITHDRAWN
Note Type
Note
Reference
gene_evolution
14-3-3 family of proteins is highly conserved among both plants and animals
61782
gene_homology
protein shares 100% sequence identity with human ywhag
61782
