Symbol:
Vcan
Name:
versican
RGD ID:
619940
Description:
Predicted to enable protein phosphatase binding activity and protein tyrosine phosphatase activator activity. Involved in axon regeneration. Located in cell surface and perineuronal net. Is active in synapse. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in intracranial aneurysm. Orthologous to human VCAN (versican); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan 2 (versican); chondroitin sulfate proteoglycan core protein 2; Cspg2; GHAP; glial hyaluronate-binding protein; large fibroblast proteoglycan; PG-M; versican core protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VCAN (versican) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Vcan (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vcan (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VCAN (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VCAN (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vcan (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VCAN (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VCAN (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vcan (versican) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CTSB (cathepsin B) HGNC
OMA
Homo sapiens (human):
GPR137C (G protein-coupled receptor 137C) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Vcan (versican)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
VCAN (versican)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vcana (versican a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
vcanb (versican b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
vcan
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 22,497,035 - 22,595,955 (-) NCBI GRCr8 mRatBN7.2 2 20,761,718 - 20,860,637 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 20,761,718 - 20,860,637 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 27,798,986 - 27,898,522 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 25,899,274 - 25,998,816 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 20,683,909 - 20,782,542 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 18,490,102 - 18,587,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 18,490,102 - 18,565,842 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 19,712,629 - 19,801,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 19,634,740 - 19,688,742 (-) NCBI Celera 2 16,903,548 - 17,002,158 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vcan Rat (S)-nicotine increases expression ISO VCAN (Homo sapiens) 6480464 Nicotine results in increased expression of VCAN mRNA CTD PMID:23825647 Vcan Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of VCAN mRNA CTD PMID:30723492 Vcan Rat 1-nitropyrene increases expression ISO VCAN (Homo sapiens) 6480464 1-nitropyrene results in increased expression of VCAN mRNA CTD PMID:19041380 Vcan Rat 17beta-estradiol increases expression ISO Vcan (Mus musculus) 6480464 Estradiol results in increased expression of VCAN mRNA CTD PMID:19484750 and PMID:30077407 Vcan Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VCAN mRNA CTD PMID:32741896 Vcan Rat 17beta-estradiol multiple interactions ISO Vcan (Mus musculus) 6480464 [Polyphenols co-treated with Estradiol] results in increased expression of VCAN mRNA CTD PMID:30077407 Vcan Rat 17beta-estradiol multiple interactions ISO VCAN (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of VCAN mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of VCAN mRNA CTD PMID:20660070 and PMID:30165855 Vcan Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VCAN mRNA CTD PMID:32741896 Vcan Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO VCAN (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO VCAN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of VCAN mRNA CTD PMID:21998131 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO VCAN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of VCAN mRNA CTD PMID:36370075 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of VCAN mRNA CTD PMID:34747641 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of VCAN mRNA CTD PMID:32109520 and PMID:33387578 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Vcan (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of VCAN mRNA CTD PMID:27562557 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vcan (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VCAN mRNA CTD PMID:18691609 and PMID:26377647 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VCAN mRNA CTD PMID:22808131 Vcan Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO VCAN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of VCAN mRNA CTD PMID:20106945 and PMID:21632981 Vcan Rat 2,4,6-tribromophenol increases expression ISO VCAN (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Vcan Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Vcan (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of VCAN mRNA] CTD PMID:18200517 Vcan Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Vcan (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of VCAN mRNA CTD PMID:18200517 Vcan Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Vcan (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Vcan Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of VCAN mRNA] and IL1B affects the reaction [Glucosamine results in decreased expression of VCAN mRNA] CTD PMID:17109745 Vcan Rat 2-amino-2-deoxy-D-glucopyranose decreases expression EXP 6480464 Glucosamine results in decreased expression of VCAN mRNA CTD PMID:17109745 Vcan Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression ISO VCAN (Homo sapiens) 6480464 Puromycin Aminonucleoside results in decreased expression of VCAN mRNA and Puromycin Aminonucleoside results in decreased expression of VCAN protein CTD PMID:15585670 Vcan Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO VCAN (Homo sapiens) 6480464 3 more ... CTD PMID:35618242 Vcan Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Vcan (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of VCAN mRNA CTD PMID:16054899 Vcan Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO VCAN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VCAN mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VCAN mRNA CTD PMID:28628672 Vcan Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of VCAN mRNA CTD PMID:30723492 Vcan Rat 4,4'-sulfonyldiphenol increases expression ISO Vcan (Mus musculus) 6480464 bisphenol S results in increased expression of VCAN mRNA CTD PMID:30951980 and PMID:37611474 Vcan Rat 4-hydroxyphenyl retinamide decreases expression ISO Vcan (Mus musculus) 6480464 Fenretinide results in decreased expression of VCAN mRNA CTD PMID:28973697 Vcan Rat 5-aza-2'-deoxycytidine affects expression ISO VCAN (Homo sapiens) 6480464 Decitabine affects the expression of VCAN mRNA CTD PMID:23300844 Vcan Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of VCAN mRNA CTD PMID:24780913 Vcan Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of VCAN mRNA CTD PMID:28959563 Vcan Rat acrylamide decreases expression ISO VCAN (Homo sapiens) 6480464 Acrylamide results in decreased expression of VCAN mRNA CTD PMID:32763439 Vcan Rat aflatoxin B1 affects expression ISO VCAN (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of VCAN protein CTD PMID:20106945 Vcan Rat aflatoxin B1 increases methylation ISO VCAN (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of VCAN intron CTD PMID:30157460 Vcan Rat aflatoxin B1 increases expression ISO VCAN (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of VCAN mRNA CTD PMID:22100608 and PMID:32234424 Vcan Rat aflatoxin M1 decreases expression ISO VCAN (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of VCAN mRNA CTD PMID:30928695 Vcan Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of VCAN mRNA] and IL1B affects the reaction [Glucosamine results in decreased expression of VCAN mRNA] CTD PMID:17109745 Vcan Rat aldehydo-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of VCAN mRNA CTD PMID:17109745 Vcan Rat all-trans-retinoic acid increases expression ISO VCAN (Homo sapiens) 6480464 Tretinoin results in increased expression of VCAN mRNA CTD PMID:23724009 Vcan Rat amiodarone affects expression ISO Vcan (Mus musculus) 6480464 Amiodarone affects the expression of VCAN protein alternative form CTD PMID:26515726 Vcan Rat amiodarone affects expression ISO VCAN (Homo sapiens) 6480464 Amiodarone affects the expression of VCAN protein alternative form CTD PMID:26515726 Vcan Rat amiodarone multiple interactions ISO Vcan (Mus musculus) 6480464 Amiodarone affects the reaction [VCAN protein alternative form affects the expression of SNAI1 protein] and Amiodarone affects the reaction [VCAN protein alternative form affects the phosphorylation of EGFR protein] CTD PMID:26515726 Vcan Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of VCAN mRNA CTD PMID:30779732 Vcan Rat aristolochic acid A decreases expression ISO VCAN (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of VCAN mRNA CTD PMID:33212167 Vcan Rat arsenite(3-) decreases expression ISO VCAN (Homo sapiens) 6480464 arsenite results in decreased expression of VCAN mRNA CTD PMID:23974009 Vcan Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of VCAN mRNA CTD PMID:20221588 Vcan Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of VCAN gene CTD PMID:35440735 Vcan Rat Azoxymethane multiple interactions ISO Vcan (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VCAN mRNA CTD PMID:29950665 Vcan Rat benzene increases expression ISO VCAN (Homo sapiens) 6480464 Benzene results in increased expression of VCAN mRNA CTD PMID:19162166 Vcan Rat benzo[a]pyrene increases mutagenesis ISO VCAN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of VCAN gene CTD PMID:25435355 Vcan Rat benzo[a]pyrene increases expression ISO VCAN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of VCAN mRNA CTD PMID:32234424 Vcan Rat benzo[a]pyrene increases methylation ISO VCAN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of VCAN 5' UTR more ... CTD PMID:27901495 Vcan Rat benzo[a]pyrene decreases expression ISO VCAN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of VCAN mRNA CTD PMID:21632981 Vcan Rat benzo[a]pyrene affects expression ISO VCAN (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of VCAN mRNA CTD PMID:20106945 Vcan Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of VCAN mRNA] and IL1B affects the reaction [Glucosamine results in decreased expression of VCAN mRNA] CTD PMID:17109745 Vcan Rat beta-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of VCAN mRNA CTD PMID:17109745 Vcan Rat bezafibrate decreases expression ISO VCAN (Homo sapiens) 6480464 Bezafibrate results in decreased expression of VCAN mRNA CTD PMID:11522680 Vcan Rat bisphenol A decreases expression ISO Vcan (Mus musculus) 6480464 bisphenol A results in decreased expression of VCAN mRNA CTD PMID:23704952 Vcan Rat bisphenol A decreases expression ISO VCAN (Homo sapiens) 6480464 bisphenol A results in decreased expression of VCAN protein CTD PMID:31675489 Vcan Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of VCAN mRNA CTD PMID:29323181 and PMID:30816183 Vcan Rat bisphenol A increases expression ISO Vcan (Mus musculus) 6480464 bisphenol A results in increased expression of VCAN mRNA CTD PMID:30951980 and PMID:35598803 Vcan Rat bisphenol A multiple interactions ISO VCAN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VCAN mRNA CTD PMID:28628672 Vcan Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of VCAN gene CTD PMID:28505145 Vcan Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VCAN mRNA CTD PMID:25181051 Vcan Rat bisphenol AF increases expression ISO VCAN (Homo sapiens) 6480464 bisphenol AF results in increased expression of VCAN protein CTD PMID:34186270 Vcan Rat Bisphenol B increases expression ISO VCAN (Homo sapiens) 6480464 bisphenol B results in increased expression of VCAN protein CTD PMID:34186270 Vcan Rat bisphenol F multiple interactions ISO VCAN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VCAN mRNA CTD PMID:28628672 Vcan Rat bisphenol F decreases expression ISO Vcan (Mus musculus) 6480464 bisphenol F results in decreased expression of VCAN mRNA CTD PMID:38685157 Vcan Rat bisphenol F increases expression ISO VCAN (Homo sapiens) 6480464 bisphenol F results in increased expression of VCAN protein CTD PMID:34186270 Vcan Rat bisphenol F increases expression ISO Vcan (Mus musculus) 6480464 bisphenol F results in increased expression of VCAN mRNA CTD PMID:30951980 Vcan Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of VCAN protein CTD PMID:28903499 Vcan Rat butan-1-ol multiple interactions ISO VCAN (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of VCAN mRNA CTD PMID:29432896 Vcan Rat butanal decreases expression ISO VCAN (Homo sapiens) 6480464 butyraldehyde results in decreased expression of VCAN mRNA CTD PMID:26079696 Vcan Rat cadmium atom decreases expression ISO VCAN (Homo sapiens) 6480464 Cadmium results in decreased expression of VCAN mRNA CTD PMID:23369406 Vcan Rat cadmium dichloride increases expression ISO VCAN (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of VCAN mRNA CTD PMID:38382870 Vcan Rat cadmium dichloride decreases expression ISO VCAN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of VCAN mRNA CTD PMID:38568856 Vcan Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of VCAN mRNA CTD PMID:25868845 Vcan Rat calcitriol decreases expression ISO VCAN (Homo sapiens) 6480464 Calcitriol results in decreased expression of VCAN mRNA CTD PMID:26485663 Vcan Rat carbamazepine affects expression ISO VCAN (Homo sapiens) 6480464 Carbamazepine affects the expression of VCAN mRNA CTD PMID:25979313 Vcan Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of VCAN mRNA CTD PMID:20211217 Vcan Rat carbofuran decreases expression EXP 6480464 Carbofuran results in decreased expression of VCAN mRNA CTD PMID:30471306 Vcan Rat carbon nanotube increases expression ISO Vcan (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Vcan Rat CGP 52608 multiple interactions ISO VCAN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to VCAN gene] CTD PMID:28238834 Vcan Rat chloropicrin increases expression ISO VCAN (Homo sapiens) 6480464 chloropicrin results in increased expression of VCAN mRNA CTD PMID:26352163 Vcan Rat chlorpyrifos decreases expression ISO Vcan (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of VCAN mRNA CTD PMID:37019170 Vcan Rat cisplatin affects expression ISO VCAN (Homo sapiens) 6480464 Cisplatin affects the expression of VCAN mRNA CTD PMID:23300844 Vcan Rat cisplatin increases expression ISO VCAN (Homo sapiens) 6480464 Cisplatin results in increased expression of VCAN mRNA CTD PMID:27392435 Vcan Rat cobalt dichloride decreases secretion ISO VCAN (Homo sapiens) 6480464 cobaltous chloride results in decreased secretion of VCAN protein CTD PMID:22079246 Vcan Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of VCAN mRNA CTD PMID:24386269 Vcan Rat cobalt dichloride decreases expression ISO VCAN (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of VCAN mRNA CTD PMID:19376846 Vcan Rat copper atom multiple interactions ISO VCAN (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of VCAN mRNA CTD PMID:24690739 Vcan Rat copper(0) multiple interactions ISO VCAN (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of VCAN mRNA CTD PMID:24690739 Vcan Rat copper(II) chloride decreases expression ISO VCAN (Homo sapiens) 6480464 cupric chloride results in decreased expression of VCAN mRNA CTD PMID:38568856 Vcan Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of VCAN mRNA CTD PMID:15755911 Vcan Rat curcumin multiple interactions ISO Vcan (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of VCAN mRNA] CTD PMID:18200517 Vcan Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of VCAN mRNA CTD PMID:21865292 Vcan Rat cyclosporin A decreases expression ISO VCAN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of VCAN mRNA CTD PMID:34681664 Vcan Rat cyclosporin A increases expression ISO VCAN (Homo sapiens) 6480464 Cyclosporine results in increased expression of VCAN mRNA CTD PMID:25562108 Vcan Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of VCAN mRNA CTD PMID:23640034 Vcan Rat decabromodiphenyl ether decreases expression ISO VCAN (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of VCAN protein CTD PMID:31675489 Vcan Rat deoxynivalenol decreases expression ISO VCAN (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of VCAN mRNA CTD PMID:31863870 Vcan Rat dexamethasone multiple interactions ISO Vcan (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of VCAN mRNA CTD PMID:16054899 Vcan Rat dexamethasone multiple interactions ISO VCAN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VCAN mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VCAN mRNA CTD PMID:28628672 Vcan Rat dexamethasone decreases expression ISO VCAN (Homo sapiens) 6480464 Dexamethasone results in decreased expression of VCAN mRNA CTD PMID:25047013 Vcan Rat dexamethasone increases expression ISO Vcan (Mus musculus) 6480464 Dexamethasone results in increased expression of VCAN mRNA CTD PMID:22733784 Vcan Rat dextran sulfate multiple interactions ISO Vcan (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VCAN mRNA CTD PMID:29950665 Vcan Rat diallyl trisulfide decreases expression ISO VCAN (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of VCAN mRNA CTD PMID:34995734 Vcan Rat Dibutyl phosphate affects expression ISO VCAN (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of VCAN mRNA CTD PMID:37042841 Vcan Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of VCAN mRNA CTD PMID:21266533 Vcan Rat diclofenac decreases expression ISO Vcan (Mus musculus) 6480464 Diclofenac results in decreased expression of VCAN mRNA CTD PMID:26934552 Vcan Rat dimethylarsinous acid decreases expression ISO VCAN (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of VCAN mRNA CTD PMID:23876855 Vcan Rat dioxygen multiple interactions ISO Vcan (Mus musculus) 6480464 [baysilon results in increased abundance of Oxygen] which results in increased expression of VCAN mRNA and [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of VCAN mRNA CTD PMID:29156398 and PMID:30529165 Vcan Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of VCAN mRNA CTD PMID:33729688 Vcan Rat dioxygen increases expression ISO VCAN (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of VCAN mRNA CTD PMID:26516004 Vcan Rat diquat decreases expression ISO Vcan (Mus musculus) 6480464 Diquat results in decreased expression of VCAN mRNA CTD PMID:36851058 Vcan Rat disulfiram multiple interactions ISO VCAN (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of VCAN mRNA CTD PMID:24690739 Vcan Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of VCAN mRNA CTD PMID:25152437 Vcan Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of VCAN mRNA CTD PMID:21983523 Vcan Rat dorsomorphin multiple interactions ISO VCAN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Vcan Rat doxorubicin increases expression ISO Vcan (Mus musculus) 6480464 Doxorubicin results in increased expression of VCAN mRNA CTD PMID:19073829 Vcan Rat doxorubicin decreases expression ISO VCAN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of VCAN mRNA CTD PMID:29803840 Vcan Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of VCAN mRNA CTD PMID:20211217 Vcan Rat doxorubicin decreases expression ISO Vcan (Mus musculus) 6480464 Doxorubicin results in decreased expression of VCAN protein CTD PMID:19073829 Vcan Rat ethanol decreases expression ISO VCAN (Homo sapiens) 6480464 Ethanol results in decreased expression of VCAN mRNA CTD PMID:28986285 Vcan Rat ethanol increases expression ISO Vcan (Mus musculus) 6480464 Ethanol results in increased expression of VCAN mRNA CTD PMID:30319688 Vcan Rat etoposide affects response to substance ISO VCAN (Homo sapiens) 6480464 VCAN protein affects the susceptibility to Etoposide CTD PMID:16217747 Vcan Rat fenoldopam increases expression EXP 6480464 Fenoldopam results in increased expression of VCAN mRNA CTD PMID:21983523 Vcan Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of VCAN mRNA CTD PMID:30307764 Vcan Rat furan increases expression EXP 6480464 furan results in increased expression of VCAN mRNA CTD PMID:27387713 Vcan Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of VCAN mRNA CTD PMID:33387578 Vcan Rat hexadecanoic acid multiple interactions ISO VCAN (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of VCAN mRNA and [Palmitic Acid co-treated with Oleic Acid] affects the expression of VCAN mRNA CTD PMID:30547786 Vcan Rat indometacin multiple interactions ISO VCAN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VCAN mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VCAN mRNA CTD PMID:28628672 Vcan Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of VCAN mRNA CTD PMID:20211217 Vcan Rat isotretinoin increases expression ISO VCAN (Homo sapiens) 6480464 Isotretinoin results in increased expression of VCAN mRNA CTD PMID:20436886 Vcan Rat ivermectin decreases expression ISO VCAN (Homo sapiens) 6480464 Ivermectin results in decreased expression of VCAN protein CTD PMID:32959892 Vcan Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of VCAN mRNA CTD PMID:20080153 Vcan Rat lead(0) affects splicing ISO VCAN (Homo sapiens) 6480464 Lead affects the splicing of VCAN mRNA CTD PMID:28903495 Vcan Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of VCAN mRNA CTD PMID:35283115 Vcan Rat lipopolysaccharide multiple interactions ISO VCAN (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Vcan Rat loliolide increases expression ISO VCAN (Homo sapiens) 6480464 loliolide results in increased expression of VCAN mRNA CTD PMID:31601058 Vcan Rat mitoxantrone affects response to substance ISO VCAN (Homo sapiens) 6480464 VCAN protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Vcan Rat monosodium L-glutamate decreases expression ISO Vcan (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of VCAN mRNA CTD PMID:22078008 Vcan Rat monosodium L-glutamate multiple interactions ISO Vcan (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of VCAN mRNA CTD PMID:22078008 Vcan Rat N-methyl-4-phenylpyridinium decreases expression ISO VCAN (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of VCAN mRNA CTD PMID:24810058 Vcan Rat nickel atom increases expression ISO VCAN (Homo sapiens) 6480464 Nickel results in increased expression of VCAN mRNA CTD PMID:24768652 and PMID:25583101 Vcan Rat nickel sulfate increases expression ISO Vcan (Mus musculus) 6480464 nickel sulfate results in increased expression of VCAN mRNA CTD PMID:16166746 Vcan Rat nickel sulfate decreases expression ISO VCAN (Homo sapiens) 6480464 nickel sulfate results in decreased expression of VCAN mRNA CTD PMID:22714537 Vcan Rat nicotine increases expression ISO VCAN (Homo sapiens) 6480464 Nicotine results in increased expression of VCAN mRNA CTD PMID:23825647 Vcan Rat oleic acid multiple interactions ISO VCAN (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of VCAN mRNA and [Palmitic Acid co-treated with Oleic Acid] affects the expression of VCAN mRNA CTD PMID:30547786 Vcan Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of VCAN mRNA CTD PMID:25729387 Vcan Rat ozone multiple interactions ISO Vcan (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of VCAN mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of VCAN mRNA CTD PMID:27106289 and PMID:34911549 Vcan Rat ozone increases expression ISO Vcan (Mus musculus) 6480464 Ozone results in increased expression of VCAN mRNA CTD PMID:33026818 Vcan Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of VCAN mRNA CTD PMID:18754875 Vcan Rat paracetamol decreases expression ISO VCAN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of VCAN mRNA CTD PMID:21420995 Vcan Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of VCAN mRNA CTD PMID:33387578 Vcan Rat paracetamol increases expression ISO VCAN (Homo sapiens) 6480464 Acetaminophen results in increased expression of VCAN mRNA CTD PMID:29067470 Vcan Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of VCAN mRNA CTD PMID:32680482 Vcan Rat paraquat increases expression ISO VCAN (Homo sapiens) 6480464 Paraquat results in increased expression of VCAN mRNA CTD PMID:34681664 Vcan Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of VCAN mRNA CTD PMID:18158353 Vcan Rat phenytoin increases expression ISO VCAN (Homo sapiens) 6480464 Phenytoin results in increased expression of VCAN mRNA CTD PMID:14741686 Vcan Rat pirinixic acid multiple interactions ISO VCAN (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of VCAN mRNA CTD PMID:19710929 Vcan Rat potassium chromate increases expression ISO VCAN (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of VCAN mRNA CTD PMID:22714537 Vcan Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of VCAN mRNA CTD PMID:20726854 Vcan Rat progesterone increases expression ISO VCAN (Homo sapiens) 6480464 Progesterone results in increased expression of VCAN mRNA CTD PMID:18692832 Vcan Rat progesterone multiple interactions ISO VCAN (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of VCAN mRNA CTD PMID:20660070 Vcan Rat rofecoxib decreases expression ISO VCAN (Homo sapiens) 6480464 rofecoxib results in decreased expression of VCAN mRNA CTD PMID:17070997 Vcan Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of VCAN mRNA CTD PMID:28374803 Vcan Rat rotenone decreases expression ISO VCAN (Homo sapiens) 6480464 Rotenone results in decreased expression of VCAN mRNA CTD PMID:29955902 Vcan Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO VCAN (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Vcan Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO VCAN (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of VCAN mRNA CTD PMID:35811015 Vcan Rat SB 431542 multiple interactions ISO VCAN (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Vcan Rat serpentine asbestos multiple interactions ISO Vcan (Mus musculus) 6480464 SPP1 gene mutant form inhibits the reaction [Asbestos and Serpentine results in increased expression of VCAN mRNA] CTD PMID:21514415 Vcan Rat serpentine asbestos increases expression ISO Vcan (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of VCAN mRNA CTD PMID:21514415 Vcan Rat silicon dioxide decreases expression ISO VCAN (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of VCAN mRNA and Silicon Dioxide results in decreased expression of VCAN mRNA CTD PMID:25351596 and PMID:25895662 Vcan Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of VCAN mRNA CTD PMID:34779285 Vcan Rat silicon dioxide increases expression ISO Vcan (Mus musculus) 6480464 Silicon Dioxide results in increased expression of VCAN mRNA CTD PMID:23221170 and PMID:29341224 Vcan Rat silicon dioxide increases expression ISO VCAN (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of VCAN mRNA CTD PMID:23806026 Vcan Rat silicon dioxide affects secretion ISO VCAN (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of VCAN protein CTD PMID:25895662 Vcan Rat silver atom decreases expression ISO VCAN (Homo sapiens) 6480464 Silver results in decreased expression of VCAN mRNA CTD PMID:26551752 Vcan Rat silver(0) decreases expression ISO VCAN (Homo sapiens) 6480464 Silver results in decreased expression of VCAN mRNA CTD PMID:26551752 Vcan Rat sirolimus increases expression EXP 6480464 Sirolimus results in increased expression of VCAN mRNA CTD PMID:21865292 Vcan Rat sodium arsenite decreases expression ISO VCAN (Homo sapiens) 6480464 sodium arsenite results in decreased expression of VCAN mRNA CTD PMID:23876855 and PMID:38568856 Vcan Rat sodium arsenite increases expression ISO VCAN (Homo sapiens) 6480464 sodium arsenite results in increased expression of VCAN mRNA CTD PMID:29301061 Vcan Rat sodium arsenite affects methylation ISO VCAN (Homo sapiens) 6480464 sodium arsenite affects the methylation of VCAN gene CTD PMID:28589171 Vcan Rat Soman increases expression EXP 6480464 Soman results in increased expression of VCAN mRNA CTD PMID:19281266 Vcan Rat sunitinib increases expression ISO VCAN (Homo sapiens) 6480464 Sunitinib results in increased expression of VCAN mRNA CTD PMID:31533062 Vcan Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of VCAN mRNA CTD PMID:21865292 Vcan Rat tert-butyl hydroperoxide decreases expression ISO VCAN (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of VCAN mRNA CTD PMID:15336504 Vcan Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VCAN mRNA CTD PMID:32741896 Vcan Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of VCAN mRNA CTD PMID:12734012 Vcan Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of VCAN mRNA CTD PMID:34492290 Vcan Rat thiram decreases expression ISO VCAN (Homo sapiens) 6480464 Thiram results in decreased expression of VCAN mRNA CTD PMID:38568856 Vcan Rat titanium dioxide multiple interactions ISO Vcan (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VCAN mRNA CTD PMID:29950665 Vcan Rat titanium dioxide increases methylation ISO Vcan (Mus musculus) 6480464 titanium dioxide results in increased methylation of VCAN gene CTD PMID:35295148 Vcan Rat titanium dioxide increases expression ISO Vcan (Mus musculus) 6480464 titanium dioxide results in increased expression of VCAN mRNA CTD PMID:35295148 Vcan Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of VCAN mRNA CTD PMID:25729387 Vcan Rat topotecan affects response to substance ISO VCAN (Homo sapiens) 6480464 VCAN protein affects the susceptibility to Topotecan CTD PMID:16217747 Vcan Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of VCAN mRNA CTD PMID:25729387 Vcan Rat tremolite asbestos increases expression ISO Vcan (Mus musculus) 6480464 tremolite results in increased expression of VCAN mRNA CTD PMID:29279043 Vcan Rat trichostatin A increases expression ISO VCAN (Homo sapiens) 6480464 trichostatin A results in increased expression of VCAN mRNA CTD PMID:24935251 and PMID:26272509 Vcan Rat trichostatin A multiple interactions ISO VCAN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of VCAN mRNA CTD PMID:27188386 Vcan Rat triclosan decreases expression ISO VCAN (Homo sapiens) 6480464 Triclosan results in decreased expression of VCAN mRNA CTD PMID:30510588 Vcan Rat triclosan increases expression ISO VCAN (Homo sapiens) 6480464 Triclosan results in increased expression of VCAN mRNA CTD PMID:34681664 Vcan Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of VCAN protein CTD PMID:32519852 Vcan Rat tris(2-butoxyethyl) phosphate affects expression ISO VCAN (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of VCAN mRNA CTD PMID:29024780 Vcan Rat troglitazone increases expression ISO Vcan (Mus musculus) 6480464 troglitazone results in increased expression of VCAN mRNA CTD PMID:28973697 Vcan Rat troglitazone increases expression ISO VCAN (Homo sapiens) 6480464 troglitazone results in increased expression of VCAN mRNA CTD PMID:19140230 Vcan Rat tunicamycin decreases expression ISO Vcan (Mus musculus) 6480464 Tunicamycin results in decreased expression of VCAN mRNA CTD PMID:17127020 Vcan Rat tunicamycin increases expression ISO Vcan (Mus musculus) 6480464 Tunicamycin results in increased expression of VCAN mRNA CTD PMID:17127020 Vcan Rat valproic acid affects expression ISO VCAN (Homo sapiens) 6480464 Valproic Acid affects the expression of VCAN mRNA CTD PMID:25979313 Vcan Rat valproic acid increases expression ISO VCAN (Homo sapiens) 6480464 Valproic Acid results in increased expression of VCAN mRNA CTD PMID:23179753 and PMID:26272509 Vcan Rat valproic acid multiple interactions ISO VCAN (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of VCAN mRNA CTD PMID:27188386 Vcan Rat valproic acid decreases expression ISO VCAN (Homo sapiens) 6480464 Valproic Acid results in decreased expression of VCAN mRNA CTD PMID:27188386 more ... Vcan Rat vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of VCAN mRNA CTD PMID:20060208 Vcan Rat vorinostat increases expression ISO VCAN (Homo sapiens) 6480464 vorinostat results in increased expression of VCAN mRNA CTD PMID:26272509
(S)-nicotine (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropyrene (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) aldehydo-D-glucosamine (EXP) all-trans-retinoic acid (ISO) amiodarone (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) astemizole (EXP) atrazine (EXP) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-D-glucosamine (EXP) bezafibrate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) butan-1-ol (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (EXP) calcitriol (ISO) carbamazepine (ISO) carbofuran (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) corticosterone (EXP) curcumin (ISO) cyclosporin A (EXP,ISO) decabromodiphenyl ether (EXP,ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diclofenac (ISO) dimethylarsinous acid (ISO) dioxygen (EXP,ISO) diquat (ISO) disulfiram (ISO) diuron (EXP) dopamine (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) ethanol (ISO) etoposide (ISO) fenoldopam (EXP) fenvalerate (EXP) furan (EXP) gentamycin (EXP) hexadecanoic acid (ISO) indometacin (ISO) isoprenaline (EXP) isotretinoin (ISO) ivermectin (ISO) ketamine (EXP) lead(0) (ISO) lidocaine (EXP) lipopolysaccharide (ISO) loliolide (ISO) mitoxantrone (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) nickel sulfate (ISO) nicotine (ISO) oleic acid (ISO) oxaliplatin (EXP) ozone (ISO) paclitaxel (EXP) paracetamol (EXP,ISO) paraquat (EXP,ISO) phenylephrine (EXP) phenytoin (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (EXP,ISO) rofecoxib (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sirolimus (EXP) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tacrolimus hydrate (EXP) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP,ISO) tremolite asbestos (ISO) trichostatin A (ISO) triclosan (ISO) Triptolide (EXP) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (EXP,ISO)
1.
Versican is upregulated in CNS injury and is a product of oligodendrocyte lineage cells.
Asher RA, etal., J Neurosci 2002 Mar 15;22(6):2225-36.
2.
Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum.
Cheng D, etal., Mol Cell Proteomics. 2006 Jun;5(6):1158-70. doi: 10.1074/mcp.D500009-MCP200. Epub 2006 Feb 28.
3.
Composition of perineuronal net extracellular matrix in rat brain: a different disaccharide composition for the net-associated proteoglycans.
Deepa SS, etal., J Biol Chem. 2006 Jun 30;281(26):17789-800. Epub 2006 Apr 27.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Expression of a chondroitin sulfate proteoglycan, versican (PG-M), during development of rat cornea.
Koga T, etal., Curr Eye Res. 2005 Jun;30(6):455-63.
7.
Versican/PG-M isoforms in vascular smooth muscle cells.
Lemire JM, etal., Arterioscler Thromb Vasc Biol 1999 Jul;19(7):1630-9.
8.
Overexpression of the V3 variant of versican alters arterial smooth muscle cell adhesion, migration, and proliferation in vitro.
Lemire JM, etal., J Cell Physiol 2002 Jan;190(1):38-45.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Differential regulation of expression of hyaluronan-binding proteoglycans in developing brain: aggrecan, versican, neurocan, and brevican.
Milev P, etal., Biochem Biophys Res Commun 1998 Jun 18;247(2):207-12.
11.
Erosive vitreoretinopathy and wagner disease are caused by intronic mutations in CSPG2/Versican that result in an imbalance of splice variants.
Mukhopadhyay A, etal., Invest Ophthalmol Vis Sci. 2006 Aug;47(8):3565-72.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
The versican gene and the risk of intracranial aneurysms.
Ruigrok YM, etal., Stroke. 2006 Sep;37(9):2372-4. Epub 2006 Aug 17.
18.
Hormone-regulated expression and localization of versican in the rodent ovary.
Russell DL, etal., Endocrinology 2003 Mar;144(3):1020-31.
19.
Changes in distribution, cell associations, and protein expression levels of NG2, neurocan, phosphacan, brevican, versican V2, and tenascin-C during acute to chronic maturation of spinal cord scar tissue.
Tang X, etal., J Neurosci Res 2003 Feb 1;71(3):427-44.
20.
Versican is induced in infiltrating monocytes in myocardial infarction.
Toeda K, etal., Mol Cell Biochem. 2005 Dec;280(1-2):47-56.
Vcan Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 22,497,035 - 22,595,955 (-) NCBI GRCr8 mRatBN7.2 2 20,761,718 - 20,860,637 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 20,761,718 - 20,860,637 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 27,798,986 - 27,898,522 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 25,899,274 - 25,998,816 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 20,683,909 - 20,782,542 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 18,490,102 - 18,587,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 18,490,102 - 18,565,842 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 19,712,629 - 19,801,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 19,634,740 - 19,688,742 (-) NCBI Celera 2 16,903,548 - 17,002,158 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
VCAN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 83,471,744 - 83,582,302 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 83,471,618 - 83,582,303 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 82,767,563 - 82,878,121 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 82,803,339 - 82,912,737 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 82,803,338 - 82,912,737 NCBI Celera 5 78,672,557 - 78,783,162 (+) NCBI Celera Cytogenetic Map 5 q14.2-q14.3 NCBI HuRef 5 77,975,785 - 78,086,373 (+) NCBI HuRef CHM1_1 5 82,200,193 - 82,311,247 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 83,960,520 - 84,071,053 (+) NCBI T2T-CHM13v2.0
Vcan Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 89,803,429 - 89,891,146 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 89,803,431 - 89,890,628 (-) Ensembl GRCm39 Ensembl GRCm38 13 89,655,309 - 89,743,027 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 89,655,312 - 89,742,509 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 89,794,915 - 89,882,117 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 90,129,514 - 90,216,773 (-) NCBI MGSCv36 mm8 Celera 13 93,253,094 - 93,340,280 (-) NCBI Celera Cytogenetic Map 13 C3 NCBI cM Map 13 45.5 NCBI
Vcan Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955418 26,967,595 - 27,078,430 (-) NCBI ChiLan1.0 ChiLan1.0
VCAN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 31,721,703 - 31,832,599 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 29,875,328 - 29,986,197 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 31,699,278 - 31,810,169 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 32,019,709 - 32,130,350 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 32,019,709 - 32,130,351 (-) Ensembl panpan1.1 panPan2
VCAN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 24,127,293 - 24,238,859 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 24,119,181 - 24,239,192 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 25,365,073 - 25,476,286 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 24,026,612 - 24,144,361 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 24,026,612 - 24,144,477 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 23,995,927 - 24,107,068 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 23,956,080 - 24,067,483 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 24,243,468 - 24,354,843 (-) NCBI UU_Cfam_GSD_1.0
Vcan Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 179,937,730 - 180,040,914 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 2,585,134 - 2,688,029 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 2,585,142 - 2,688,029 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VCAN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 91,384,391 - 91,811,208 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 91,682,177 - 91,811,674 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 93,783,322 - 93,895,492 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VCAN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 77,581,627 - 77,692,495 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 77,593,449 - 77,690,616 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 26,489,259 - 26,600,350 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vcan
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
2
20798941
20798942
C
T
snv
WKY/NCrl (2019) , WKY/N (2020), BUF/MnaMcwi (2022), WKY/NCrl (2019NG), European Variation Archive Release 4, European Variation Archive Release 6, SHR/NHsd (2021), European Variation Archive Release 3 View more Information
2
20800394
20800395
A
C
snv
ACI/EurMcwi (2019) , ACI/N (2020), BXH2/CubMcwi (2020), BXH3/CubMcwi (2020), DA/OlaHsd (2019), F344/DuCrl (2019), F344/NCrl (2019), F344/N (2020), F344/Stm (2019), FHH/EurMcwi (2019), FXLE16/Stm (2020), FXLE18/Stm (2020), GK/FarMcwi (2019), HXB20/IpcvMcwi (2020), HXB31/IpcvMcwi (2019), LEW/Crl (2019), LEXF11/Stm (2020), LEXF1A/Stm (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), LEXF4/Stm (2020), LE/Stm (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), LEXF10A/StmMcwi (2020), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WKY/NCrl (2019), WKY/N (2020), WN/N (2020), ACI/EurMcwi (2019NG), BDIX/NemOdaMcwi (2022), BUF/MnaMcwi (2022), DA/OlaHsd (2019NG), F344/DuCrl (2019NG), F344/DuCrl (2019NG), F344/DuCrl (2021), European Variation Archive Release 3, European Variation Archive Release 4, LEXF2A/StmMcwi (2023), FXLE26/StmMcwi (2023), FXLE22/StmMcwi (2023), FXLE20/StmMcwi (2023), LEXF8D/StmMcwi (2023), BXH2/CubMcwi (2023), FXLE23/StmMcwi (2023), LEXF10C/StmMcwi (2023), FXLE17/StmMcwi (2023), LEXF6B/StmMcwi (2023), FXLE15/StmMcwi (2023), FXLE14/StmMcwi (2023), FXLE21/StmMcwi (2023), FXLE13/StmMcwi (2023), LEXF5/StmMcwi (2023), FXLE25/StmMcwi (2023), FXLE12/StmMcwi (2023), European Variation Archive Release 6, F344/NHsd (2021), F344/StmMcwi (2019), FHH/EurMcwi (2019NG), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE13/Stm (2019NG), FXLE14/Stm (2019NG), FXLE15/StmMcwi (2021), FXLE15/Stm (2019NG), FXLE17/Stm (2019NG), FXLE19/StmMcwi (2022), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE25/Stm (2022), FXLE26/Stm (2022), GK/FarMcwi (2019NG), HXB18/IpcvMcwi (2021), LEW/Crl (2019NG), LEXF10B/StmMcwi (2022), LEXF10C/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF2C/StmMcwi (2022), LEXF5/Stm (2019NG), LEXF6B/Stm (2019NG), LEXF7A/Stm (2019NG), LEXF7B/StmMcwi (2022), LEXF7C/StmMcwi (2022), LEXF8A/StmMcwi (2021), LEXF8D/Stm (2022), LEXF9/StmMcwi (2022), MR/NRrrc (2022), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), SHRSP/A3NCrl (2019NG), SHR/NCrl (2021), SHR/NHsd (2021), SHR/NHsd (2021), SHR/OlalpcvMcwi (2019NG), SS/HsdMcwiCrl (2021), SS/JrHsdMcwi (2019NG), SS/JrHsd (2021), WKY/NCrl (2019NG) View more Information
2
20816442
20816443
A
G
snv
MR/N (2020) , PVG/Seac (2019), WKY/NCrl (2019), WKY/N (2020), WN/N (2020), WKY/NCrl (2019NG), European Variation Archive Release 3, European Variation Archive Release 4, European Variation Archive Release 6, MR/NRrrc (2022), SHR/NHsd (2021), BUF/MnaMcwi (2022) View more Information
Predicted Target Of
Count of predictions: 1336 Count of miRNA genes: 308 Interacting mature miRNAs: 399 Transcripts: ENSRNOT00000045532, ENSRNOT00000063821, ENSRNOT00000067456 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 61368 Mcs1 Mammary carcinoma susceptibility QTL 1 4.4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 23319447 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat
RH134008
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 q12 UniSTS
RH143691
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 20,762,051 - 20,762,170 (+) MAPPER mRatBN7.2 Rnor_6.0 2 18,490,436 - 18,490,554 NCBI Rnor6.0 Rnor_5.0 2 18,364,224 - 18,364,342 UniSTS Rnor5.0 RGSC_v3.4 2 19,712,963 - 19,713,081 UniSTS RGSC3.4 Celera 2 16,903,882 - 16,904,000 UniSTS Cytogenetic Map 2 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045532 ⟹ ENSRNOP00000045935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 20,761,718 - 20,860,539 (-) Ensembl Rnor_6.0 Ensembl 2 18,514,668 - 18,565,842 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000063821 ⟹ ENSRNOP00000062961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 20,761,718 - 20,860,539 (-) Ensembl Rnor_6.0 Ensembl 2 18,490,102 - 18,565,842 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067456 ⟹ ENSRNOP00000058873
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 20,761,718 - 20,860,539 (-) Ensembl Rnor_6.0 Ensembl 2 18,490,102 - 18,565,842 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088313 ⟹ ENSRNOP00000074854
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 20,761,718 - 20,860,637 (-) Ensembl Rnor_6.0 Ensembl 2 18,492,018 - 18,531,210 (-) Ensembl
RefSeq Acc Id:
NM_001170558 ⟹ NP_001164029
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 22,497,035 - 22,595,857 (-) NCBI mRatBN7.2 2 20,761,718 - 20,860,539 (-) NCBI Rnor_6.0 2 18,490,102 - 18,587,242 (-) NCBI Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Celera 2 16,903,548 - 17,002,060 (-) NCBI
Sequence:
GAACTTGCAGGCGAGCTGCCCCGAGCCTTTCTGGGTGAAGAACTCAAGGCGCGCGGGCGCAGCAGCTGCGAGCATTAGGTGCTGAGGACCGGCGCCGGAACCGGGATCAGCCGCGAGCTGCGCATCCT
hide sequence
RefSeq Acc Id:
NM_001170559 ⟹ NP_001164030
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 22,497,035 - 22,595,857 (-) NCBI mRatBN7.2 2 20,761,718 - 20,860,539 (-) NCBI Rnor_6.0 2 18,490,102 - 18,587,242 (-) NCBI Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Celera 2 16,903,548 - 17,002,060 (-) NCBI
Sequence:
GAACTTGCAGGCGAGCTGCCCCGAGCCTTTCTGGGTGAAGAACTCAAGGCGCGCGGGCGCAGCAGCTGCGAGCATTAGGTGCTGAGGACCGGCGCCGGAACCGGGATCAGCCGCGAGCTGCGCATCCT
hide sequence
RefSeq Acc Id:
NM_001170560 ⟹ NP_001164031
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 22,497,035 - 22,595,857 (-) NCBI mRatBN7.2 2 20,761,718 - 20,860,539 (-) NCBI Rnor_6.0 2 18,490,102 - 18,587,242 (-) NCBI Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Celera 2 16,903,548 - 17,002,060 (-) NCBI
Sequence:
GAACTTGCAGGCGAGCTGCCCCGAGCCTTTCTGGGTGAAGAACTCAAGGCGCGCGGGCGCAGCAGCTGCGAGCATTAGGTGCTGAGGACCGGCGCCGGAACCGGGATCAGCCGCGAGCTGCGCATCCT
hide sequence
RefSeq Acc Id:
NM_053663 ⟹ NP_446115
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 22,497,035 - 22,595,955 (-) NCBI mRatBN7.2 2 20,761,718 - 20,860,637 (-) NCBI Rnor_6.0 2 18,490,102 - 18,587,340 (-) NCBI Rnor_5.0 2 18,363,890 - 18,463,115 (-) NCBI Celera 2 16,903,548 - 17,002,158 (-) NCBI
Sequence:
ATGAACCCTCCTCCTCTCCCTCCTCCTTCTTGCTGAGTCTCCTCCTCAGCTCTGACGGTACAGT
hide sequence
RefSeq Acc Id:
NP_446115 ⟸ NM_053663
- Peptide Label:
isoform 2 precursor
- UniProtKB:
Q9R1K4 (UniProtKB/Swiss-Prot), Q9ERB4 (UniProtKB/Swiss-Prot), O88564 (UniProtKB/Swiss-Prot), O08592 (UniProtKB/Swiss-Prot), A0A0G2K944 (UniProtKB/TrEMBL), A6I4N2 (UniProtKB/TrEMBL)
- Sequence:
MLINMNGILWMCSTLLLTHALHKAKMEENPPVKGSLSGKVILPCHFSTLPTLPPDYNTSEFLRIKWSKIEVDKNGKDIKETTVLVAQDGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAGVY
hide sequence
RefSeq Acc Id:
NP_001164030 ⟸ NM_001170559
- Peptide Label:
isoform 4 precursor
- UniProtKB:
A6I4N1 (UniProtKB/TrEMBL)
- Sequence:
MLINMNGILWMCSTLLLTHALHKAKMEENPPVKGSLSGKVILPCHFSTLPTLPPDYNTSEFLRIKWSKIEVDKNGKDIKETTVLVAQDGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAGVY
hide sequence
RefSeq Acc Id:
NP_001164031 ⟸ NM_001170560
- Peptide Label:
isoform 3 precursor
- UniProtKB:
D3Z9N6 (UniProtKB/TrEMBL)
- Sequence:
MLINMNGILWMCSTLLLTHALHKAKMEENPPVKGSLSGKVILPCHFSTLPTLPPDYNTSEFLRI
hide sequence
RefSeq Acc Id:
NP_001164029 ⟸ NM_001170558
- Peptide Label:
isoform 1 precursor
- UniProtKB:
D4A8Y6 (UniProtKB/TrEMBL)
- Sequence:
MLINMNGILWMCSTLLLTHALHKAKMEENPPVKGSLSGKVILPCHFSTLPTLPPDYNTSEFLRI
hide sequence
Ensembl Acc Id:
ENSRNOP00000058873 ⟸ ENSRNOT00000067456
Ensembl Acc Id:
ENSRNOP00000045935 ⟸ ENSRNOT00000045532
Ensembl Acc Id:
ENSRNOP00000062961 ⟸ ENSRNOT00000063821
Ensembl Acc Id:
ENSRNOP00000074854 ⟸ ENSRNOT00000088313
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-22
Vcan
versican
Cspg2
chondroitin sulfate proteoglycan 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Cspg2
chondroitin sulfate proteoglycan 2
chondroitin sulfate proteoglycan 2 (versican)
Name updated
1299863 APPROVED
2002-08-07
Cspg2
chondroitin sulfate proteoglycan 2 (versican)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
present in vascular smooth muscle cells (SMCs)
632588
gene_expression
localized around newly formed corpora lutea and vasculature immediately after ovulation
1299255
gene_regulation
FSH and testosterone increase mRNA expression in ovarian tissue
1299255
