Symbol:
Dlk1
Name:
delta like non-canonical Notch ligand 1
RGD ID:
619931
Description:
Predicted to enable calcium ion binding activity. Involved in cell differentiation. Predicted to be located in external side of plasma membrane and extracellular space. Predicted to be active in membrane. Orthologous to human DLK1 (delta like non-canonical Notch ligand 1); PARTICIPATES IN forkhead class A signaling pathway; Notch signaling pathway; p38 MAPK signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
delta-like 1; delta-like 1 homolog; delta-like 1 homolog (Drosophila); delta-like homolog (Drosophila); DLK-1; preadipocyte factor 1; preadipocyte factor-1; Pref-1; protein delta homolog 1; Zog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 134,192,491 - 134,199,779 (+) NCBI GRCr8 mRatBN7.2 6 128,410,216 - 128,417,518 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 128,410,316 - 128,417,522 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 128,550,763 - 128,557,963 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 128,846,606 - 128,853,806 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 128,207,854 - 128,215,027 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 133,576,513 - 133,583,751 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 133,552,821 - 133,583,751 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 142,742,149 - 142,749,166 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 134,022,016 - 134,043,058 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 134,028,202 - 134,035,262 (+) NCBI Celera 6 125,960,411 - 125,967,475 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dlk1 Rat 1,2-dimethylhydrazine increases expression ISO Dlk1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DLK1 mRNA CTD PMID:22206623 Dlk1 Rat 1,4-bis(2-ethylhexyl) sulfosuccinate decreases expression ISO Dlk1 (Mus musculus) 6480464 Dioctyl Sulfosuccinic Acid results in decreased expression of DLK1 mRNA CTD PMID:26135921 Dlk1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of DLK1 mRNA CTD PMID:17557909 Dlk1 Rat 17beta-estradiol decreases expression ISO DLK1 (Homo sapiens) 6480464 Estradiol results in decreased expression of DLK1 mRNA CTD PMID:23094148 Dlk1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of DLK1 mRNA CTD PMID:32145629 Dlk1 Rat 17beta-estradiol multiple interactions ISO DLK1 (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in decreased expression of DLK1 mRNA] CTD PMID:23094148 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dlk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DLK1 mRNA CTD PMID:19933214 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DLK1 mRNA CTD PMID:34747641 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DLK1 mRNA CTD PMID:32109520 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects methylation ISO DLK1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the methylation of DLK1 5' UTR and Tetrachlorodibenzodioxin affects the methylation of DLK1 exon CTD PMID:28011154 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dlk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DLK1 mRNA CTD PMID:26377647 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dlk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Carbon Tetrachloride] results in increased expression of DLK1 mRNA CTD PMID:27693115 Dlk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DLK1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DLK1 mRNA CTD PMID:20106945 and PMID:21632981 Dlk1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of DLK1 mRNA and 2-Acetylaminofluorene results in increased expression of DLK1 protein CTD PMID:15567716 more ... Dlk1 Rat 2-amino-2-deoxy-D-glucopyranose 6-phosphate decreases expression ISO Dlk1 (Mus musculus) 6480464 glucosamine 6-phosphate results in decreased expression of DLK1 mRNA CTD PMID:19427183 Dlk1 Rat 2-methylcholine affects expression ISO DLK1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DLK1 mRNA CTD PMID:21179406 Dlk1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Dlk1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Dlk1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of DLK1 mRNA CTD PMID:30496566 Dlk1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Dlk1 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA and silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA] CTD PMID:25559859 Dlk1 Rat 4,4'-sulfonyldiphenol increases expression ISO Dlk1 (Mus musculus) 6480464 bisphenol S results in increased expression of DLK1 mRNA CTD PMID:30951980 Dlk1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Dlk1 (Mus musculus) 6480464 bisphenol S affects the methylation of DLK1 gene CTD PMID:31683443 Dlk1 Rat 5-aza-2'-deoxycytidine decreases methylation ISO DLK1 (Homo sapiens) 6480464 Decitabine results in decreased methylation of DLK1 promoter CTD PMID:19194470 Dlk1 Rat 5-aza-2'-deoxycytidine affects expression ISO DLK1 (Homo sapiens) 6480464 Decitabine affects the expression of DLK1 mRNA CTD PMID:23300844 Dlk1 Rat 5-aza-2'-deoxycytidine increases expression ISO DLK1 (Homo sapiens) 6480464 Decitabine results in increased expression of DLK1 mRNA CTD PMID:19194470 Dlk1 Rat 5-azacytidine decreases methylation ISO DLK1 (Homo sapiens) 6480464 Azacitidine results in decreased methylation of DLK1 promoter CTD PMID:19194470 Dlk1 Rat 5-fluorouracil multiple interactions ISO DLK1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of DLK1 mRNA] CTD PMID:15016801 Dlk1 Rat 5-fluorouracil increases expression ISO DLK1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of DLK1 mRNA CTD PMID:24737281 Dlk1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DLK1 mRNA CTD PMID:30047161 Dlk1 Rat aflatoxin B1 increases expression ISO Dlk1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of DLK1 mRNA CTD PMID:19770486 Dlk1 Rat aldehydo-D-glucosamine 6-phosphate decreases expression ISO Dlk1 (Mus musculus) 6480464 glucosamine 6-phosphate results in decreased expression of DLK1 mRNA CTD PMID:19427183 Dlk1 Rat aldehydo-D-glucose multiple interactions ISO Dlk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DLK1 mRNA CTD PMID:37567420 Dlk1 Rat all-trans-retinoic acid increases expression ISO Dlk1 (Mus musculus) 6480464 Tretinoin results in increased expression of DLK1 mRNA CTD PMID:16604517 Dlk1 Rat all-trans-retinoic acid multiple interactions ISO Dlk1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of DLK1 mRNA CTD PMID:30951980 Dlk1 Rat all-trans-retinoic acid decreases expression ISO DLK1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DLK1 mRNA CTD PMID:16012519 more ... Dlk1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of DLK1 mRNA CTD PMID:30047161 Dlk1 Rat arsane affects expression ISO DLK1 (Homo sapiens) 6480464 Arsenic affects the expression of DLK1 protein CTD PMID:24675094 Dlk1 Rat arsane affects methylation ISO DLK1 (Homo sapiens) 6480464 Arsenic affects the methylation of DLK1 gene CTD PMID:25304211 Dlk1 Rat arsenic atom affects expression ISO DLK1 (Homo sapiens) 6480464 Arsenic affects the expression of DLK1 protein CTD PMID:24675094 Dlk1 Rat arsenic atom affects methylation ISO DLK1 (Homo sapiens) 6480464 Arsenic affects the methylation of DLK1 gene CTD PMID:25304211 Dlk1 Rat arsenous acid affects response to substance ISO DLK1 (Homo sapiens) 6480464 DLK1 protein affects the susceptibility to Arsenic Trioxide CTD PMID:18575777 Dlk1 Rat atrazine increases expression ISO DLK1 (Homo sapiens) 6480464 Atrazine results in increased expression of DLK1 mRNA CTD PMID:22378314 Dlk1 Rat Azoxymethane multiple interactions ISO Dlk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 mRNA CTD PMID:29950665 Dlk1 Rat baicalein increases expression ISO Dlk1 (Mus musculus) 6480464 baicalein results in increased expression of DLK1 mRNA CTD PMID:24560969 Dlk1 Rat benzalkonium chloride decreases expression ISO Dlk1 (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of DLK1 mRNA CTD PMID:31199489 Dlk1 Rat benzo[a]pyrene decreases expression ISO Dlk1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DLK1 mRNA CTD PMID:20127859 and PMID:22228805 Dlk1 Rat benzo[a]pyrene affects methylation ISO DLK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DLK1 promoter CTD PMID:27901495 Dlk1 Rat benzo[a]pyrene decreases expression ISO DLK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DLK1 mRNA CTD PMID:20106945 and PMID:21632981 Dlk1 Rat benzo[e]pyrene increases methylation ISO DLK1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of DLK1 polyA tail CTD PMID:30157460 Dlk1 Rat bezafibrate increases expression EXP 6480464 Bezafibrate results in increased expression of DLK1 mRNA CTD PMID:11473052 Dlk1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Dlk1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of DLK1 mRNA CTD PMID:28085963 Dlk1 Rat bisphenol A decreases expression ISO Dlk1 (Mus musculus) 6480464 bisphenol A results in decreased expression of DLK1 mRNA CTD PMID:26063408 Dlk1 Rat bisphenol A decreases methylation ISO DLK1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of DLK1 gene CTD PMID:31601247 Dlk1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DLK1 mRNA CTD PMID:30816183 more ... Dlk1 Rat bisphenol A affects expression ISO DLK1 (Homo sapiens) 6480464 bisphenol A affects the expression of DLK1 mRNA CTD PMID:30903817 Dlk1 Rat bisphenol A increases expression ISO Dlk1 (Mus musculus) 6480464 bisphenol A results in increased expression of DLK1 mRNA CTD PMID:30951980 more ... Dlk1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DLK1 mRNA CTD PMID:25181051 and PMID:32145629 Dlk1 Rat Bisphenol A diglycidyl ether decreases expression ISO DLK1 (Homo sapiens) 6480464 bisphenol A diglycidyl ether results in decreased expression of DLK1 mRNA CTD PMID:22763116 Dlk1 Rat Bisphenol A diglycidyl ether decreases expression ISO Dlk1 (Mus musculus) 6480464 bisphenol A diglycidyl ether results in decreased expression of DLK1 mRNA CTD PMID:22763116 Dlk1 Rat bisphenol F multiple interactions ISO Dlk1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of DLK1 mRNA CTD PMID:30951980 Dlk1 Rat bisphenol F increases expression ISO Dlk1 (Mus musculus) 6480464 bisphenol F results in increased expression of DLK1 mRNA CTD PMID:30951980 Dlk1 Rat bleomycin A2 increases expression ISO Dlk1 (Mus musculus) 6480464 Bleomycin results in increased expression of DLK1 protein CTD PMID:29175452 Dlk1 Rat carbamazepine affects expression ISO DLK1 (Homo sapiens) 6480464 Carbamazepine affects the expression of DLK1 mRNA CTD PMID:25979313 Dlk1 Rat chlorpyrifos increases expression ISO Dlk1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DLK1 mRNA CTD PMID:37019170 Dlk1 Rat cisplatin affects expression ISO DLK1 (Homo sapiens) 6480464 Cisplatin affects the expression of DLK1 mRNA CTD PMID:23300844 Dlk1 Rat cobalt atom increases expression ISO Dlk1 (Mus musculus) 6480464 Cobalt results in increased expression of DLK1 mRNA CTD PMID:34468815 Dlk1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of DLK1 mRNA CTD PMID:26033743 Dlk1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of DLK1 mRNA CTD PMID:26033743 Dlk1 Rat copper(II) sulfate decreases expression ISO DLK1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DLK1 mRNA CTD PMID:19549813 Dlk1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DLK1 mRNA CTD PMID:26577399 Dlk1 Rat cyclosporin A decreases expression ISO DLK1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DLK1 mRNA CTD PMID:25562108 Dlk1 Rat D-glucose multiple interactions ISO Dlk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DLK1 mRNA CTD PMID:37567420 Dlk1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of DLK1 mRNA CTD PMID:23166830 Dlk1 Rat dexamethasone decreases expression ISO Dlk1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of DLK1 mRNA CTD PMID:25851902 Dlk1 Rat dexamethasone multiple interactions ISO Dlk1 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA and silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA] CTD PMID:25559859 Dlk1 Rat dextran sulfate multiple interactions ISO Dlk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 mRNA CTD PMID:29950665 Dlk1 Rat diarsenic trioxide affects response to substance ISO DLK1 (Homo sapiens) 6480464 DLK1 protein affects the susceptibility to Arsenic Trioxide CTD PMID:18575777 Dlk1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of DLK1 mRNA CTD PMID:36653537 and PMID:37077353 Dlk1 Rat dorsomorphin multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dlk1 Rat doxorubicin decreases expression ISO DLK1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DLK1 mRNA CTD PMID:30031762 Dlk1 Rat entinostat multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat entinostat decreases expression ISO DLK1 (Homo sapiens) 6480464 entinostat results in decreased expression of DLK1 mRNA CTD PMID:26272509 Dlk1 Rat ethanol increases expression ISO Dlk1 (Mus musculus) 6480464 Ethanol results in increased expression of DLK1 mRNA CTD PMID:30319688 Dlk1 Rat ethanol affects expression ISO Dlk1 (Mus musculus) 6480464 Ethanol affects the expression of DLK1 mRNA CTD PMID:30319688 Dlk1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of DLK1 mRNA CTD PMID:23962444 Dlk1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of DLK1 mRNA CTD PMID:18035473 Dlk1 Rat folic acid multiple interactions ISO Dlk1 (Mus musculus) 6480464 [Folic Acid co-treated with sodium arsenite] results in decreased methylation of DLK1 mRNA CTD PMID:22959928 Dlk1 Rat fructose multiple interactions ISO Dlk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DLK1 mRNA CTD PMID:37567420 Dlk1 Rat genistein increases expression ISO Dlk1 (Mus musculus) 6480464 Genistein results in increased expression of DLK1 mRNA CTD PMID:18359623 and PMID:32186404 Dlk1 Rat glucose multiple interactions ISO Dlk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DLK1 mRNA CTD PMID:37567420 Dlk1 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of DLK1 mRNA CTD PMID:24915197 Dlk1 Rat glyphosate increases expression ISO Dlk1 (Mus musculus) 6480464 Glyphosate results in increased expression of DLK1 mRNA CTD PMID:35897073 Dlk1 Rat herbicide multiple interactions ISO Dlk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DLK1 mRNA CTD PMID:37567420 Dlk1 Rat hydrogen peroxide increases expression ISO DLK1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of DLK1 mRNA CTD PMID:32949572 Dlk1 Rat indometacin increases expression ISO DLK1 (Homo sapiens) 6480464 Indomethacin results in increased expression of DLK1 mRNA CTD PMID:24737281 Dlk1 Rat inulin multiple interactions ISO Dlk1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DLK1 mRNA CTD PMID:36331819 Dlk1 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of DLK1 mRNA CTD PMID:37077353 Dlk1 Rat lead(0) decreases expression ISO DLK1 (Homo sapiens) 6480464 Lead results in decreased expression of DLK1 mRNA CTD PMID:37467947 Dlk1 Rat lipopolysaccharide decreases expression ISO Dlk1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of DLK1 mRNA CTD PMID:12057914 Dlk1 Rat manganese(II) chloride increases methylation ISO DLK1 (Homo sapiens) 6480464 manganese chloride results in increased methylation of DLK1 gene CTD PMID:27913844 Dlk1 Rat manganese(II) chloride decreases expression ISO DLK1 (Homo sapiens) 6480464 manganese chloride results in decreased expression of DLK1 mRNA CTD PMID:27913844 Dlk1 Rat methapyrilene increases methylation ISO DLK1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of DLK1 polyA tail CTD PMID:30157460 Dlk1 Rat methylmercury chloride increases expression ISO DLK1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DLK1 mRNA CTD PMID:34089799 Dlk1 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of DLK1 mRNA CTD PMID:28954212 Dlk1 Rat N-methyl-4-phenylpyridinium increases expression ISO DLK1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of DLK1 mRNA CTD PMID:24810058 Dlk1 Rat panobinostat decreases expression ISO DLK1 (Homo sapiens) 6480464 panobinostat results in decreased expression of DLK1 mRNA CTD PMID:26272509 Dlk1 Rat panobinostat multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of DLK1 mRNA CTD PMID:32680482 Dlk1 Rat pentanal increases expression ISO DLK1 (Homo sapiens) 6480464 pentanal results in increased expression of DLK1 mRNA CTD PMID:26079696 Dlk1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dlk1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DLK1 mRNA CTD PMID:36331819 Dlk1 Rat phenylmercury acetate decreases expression ISO DLK1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of DLK1 mRNA CTD PMID:26272509 Dlk1 Rat phenylmercury acetate multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat phorbol 13-acetate 12-myristate affects response to substance ISO DLK1 (Homo sapiens) 6480464 DLK1 protein affects the susceptibility to Tetradecanoylphorbol Acetate CTD PMID:18575777 Dlk1 Rat prednisone decreases expression ISO Dlk1 (Mus musculus) 6480464 Prednisone results in decreased expression of DLK1 mRNA CTD PMID:38439560 Dlk1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of DLK1 mRNA CTD PMID:30047161 Dlk1 Rat resveratrol multiple interactions ISO DLK1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of DLK1 mRNA CTD PMID:23557933 Dlk1 Rat rotenone increases expression ISO DLK1 (Homo sapiens) 6480464 Rotenone results in increased expression of DLK1 mRNA CTD PMID:29955902 Dlk1 Rat sarin decreases expression ISO DLK1 (Homo sapiens) 6480464 Sarin results in decreased expression of DLK1 mRNA CTD PMID:19522546 Dlk1 Rat SB 431542 multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dlk1 Rat silibinin multiple interactions ISO Dlk1 (Mus musculus) 6480464 Silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA] CTD PMID:25559859 Dlk1 Rat silicon dioxide increases expression ISO DLK1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DLK1 mRNA and Silicon Dioxide results in increased expression of DLK1 mRNA CTD PMID:25895662 and PMID:34973136 Dlk1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of DLK1 mRNA CTD PMID:22431001 Dlk1 Rat sodium arsenite multiple interactions ISO Dlk1 (Mus musculus) 6480464 [Folic Acid co-treated with sodium arsenite] results in decreased methylation of DLK1 mRNA CTD PMID:22959928 Dlk1 Rat sodium arsenite affects expression ISO Dlk1 (Mus musculus) 6480464 sodium arsenite affects the expression of DLK1 mRNA CTD PMID:28206643 Dlk1 Rat sunitinib decreases expression ISO DLK1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DLK1 mRNA CTD PMID:31533062 Dlk1 Rat tetrachloromethane multiple interactions ISO Dlk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Carbon Tetrachloride] results in increased expression of DLK1 mRNA CTD PMID:27693115 Dlk1 Rat thalidomide decreases expression ISO Dlk1 (Mus musculus) 6480464 Thalidomide results in decreased expression of DLK1 mRNA CTD PMID:26217789 Dlk1 Rat thapsigargin decreases expression ISO DLK1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of DLK1 mRNA CTD PMID:22378314 Dlk1 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of DLK1 mRNA CTD PMID:30012374 Dlk1 Rat titanium dioxide increases methylation ISO Dlk1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of DLK1 gene CTD PMID:35295148 Dlk1 Rat titanium dioxide decreases methylation ISO Dlk1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DLK1 gene and titanium dioxide results in decreased methylation of DLK1 promoter CTD PMID:35295148 Dlk1 Rat titanium dioxide multiple interactions ISO Dlk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 mRNA CTD PMID:29950665 Dlk1 Rat tributylstannane decreases expression ISO Dlk1 (Mus musculus) 6480464 tributyltin results in decreased expression of DLK1 mRNA CTD PMID:23322813 and PMID:24513447 Dlk1 Rat trichostatin A decreases expression ISO DLK1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of DLK1 mRNA CTD PMID:24935251 and PMID:26272509 Dlk1 Rat trichostatin A multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat triflumizole decreases expression ISO Dlk1 (Mus musculus) 6480464 triflumizol results in decreased expression of DLK1 mRNA CTD PMID:23086663 Dlk1 Rat tunicamycin decreases expression ISO DLK1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of DLK1 mRNA CTD PMID:22378314 Dlk1 Rat valproic acid affects expression ISO DLK1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DLK1 mRNA CTD PMID:25979313 Dlk1 Rat valproic acid increases methylation ISO DLK1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of DLK1 gene CTD PMID:29154799 Dlk1 Rat valproic acid increases expression ISO Dlk1 (Mus musculus) 6480464 Valproic Acid results in increased expression of DLK1 mRNA CTD PMID:24896083 Dlk1 Rat valproic acid decreases expression ISO DLK1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DLK1 mRNA CTD PMID:23179753 more ... Dlk1 Rat valproic acid multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat vorinostat multiple interactions ISO DLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DLK1 mRNA CTD PMID:27188386 Dlk1 Rat vorinostat decreases expression ISO DLK1 (Homo sapiens) 6480464 vorinostat results in decreased expression of DLK1 mRNA CTD PMID:26272509
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 1,4-bis(2-ethylhexyl) sulfosuccinate (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (EXP) 2-amino-2-deoxy-D-glucopyranose 6-phosphate (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aldehydo-D-glucosamine 6-phosphate (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) Azoxymethane (ISO) baicalein (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bezafibrate (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol F (ISO) bleomycin A2 (ISO) carbamazepine (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt atom (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diethylstilbestrol (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) fipronil (EXP) flavonoids (EXP) folic acid (ISO) fructose (ISO) genistein (ISO) glucose (ISO) glycidol (EXP) glyphosate (ISO) herbicide (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) ketoconazole (EXP) lead(0) (ISO) lipopolysaccharide (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methylmercury chloride (ISO) monosodium L-glutamate (EXP) N-methyl-4-phenylpyridinium (ISO) panobinostat (ISO) paraquat (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) prednisone (ISO) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) rotenone (ISO) sarin (ISO) SB 431542 (ISO) silibinin (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (ISO) thalidomide (ISO) thapsigargin (ISO) titanium dioxide (EXP,ISO) tributylstannane (ISO) trichostatin A (ISO) triflumizole (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Growth hormone and prolactin stimulate the expression of rat preadipocyte factor-1/delta-like protein in pancreatic islets: molecular cloning and expression pattern during development and growth of the endocrine pancreas.
Carlsson C, etal., Endocrinology 1997 Sep;138(9):3940-8.
2.
Mechanisms and functions of p38 MAPK signalling.
Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
3.
Hepatocyte-Specific Arid1a Deficiency Initiates Mouse Steatohepatitis and Hepatocellular Carcinoma.
Fang JZ, etal., PLoS One. 2015 Nov 16;10(11):e0143042. doi: 10.1371/journal.pone.0143042. eCollection 2015.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Cloning of a membrane-spanning protein with epidermal growth factor-like repeat motifs from adrenal glomerulosa cells.
Halder SK, etal., Endocrinology 1998 Jul;139(7):3316-28.
7.
The human Delta-like 1 homologue is implicated in the progression of liver fibrosis in biliary atresia.
Huang CC, etal., J Pathol. 2004 Feb;202(2):172-9.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Parent-of-origin effects implicate epigenetic regulation of experimental autoimmune encephalomyelitis and identify imprinted Dlk1 as a novel risk gene.
Stridh P, etal., PLoS Genet. 2014 Mar 27;10(3):e1004265. doi: 10.1371/journal.pgen.1004265. eCollection 2014 Mar.
16.
Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
Wilhelm M, etal., J Biol Chem. 2012 Jan 13;287(3):2247-56. doi: 10.1074/jbc.M111.269431. Epub 2011 Nov 28.
17.
DLK1: increased expression in gliomas and associated with oncogenic activities.
Yin D, etal., Oncogene. 2006 Mar 23;25(13):1852-61.
Dlk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 134,192,491 - 134,199,779 (+) NCBI GRCr8 mRatBN7.2 6 128,410,216 - 128,417,518 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 128,410,316 - 128,417,522 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 128,550,763 - 128,557,963 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 128,846,606 - 128,853,806 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 128,207,854 - 128,215,027 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 133,576,513 - 133,583,751 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 133,552,821 - 133,583,751 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 142,742,149 - 142,749,166 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 134,022,016 - 134,043,058 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 134,028,202 - 134,035,262 (+) NCBI Celera 6 125,960,411 - 125,967,475 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
DLK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 100,726,892 - 100,738,224 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 100,725,705 - 100,738,224 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 101,193,229 - 101,204,561 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 100,263,006 - 100,271,213 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 100,263,005 - 100,271,210 NCBI Celera 14 81,247,286 - 81,255,551 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 81,373,717 - 81,381,968 (+) NCBI HuRef CHM1_1 14 101,130,974 - 101,139,248 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 94,961,805 - 94,973,139 (+) NCBI T2T-CHM13v2.0
Dlk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 109,418,411 - 109,429,262 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 109,418,749 - 109,429,262 (+) Ensembl GRCm39 Ensembl GRCm38 12 109,452,485 - 109,463,336 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 109,452,823 - 109,463,336 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 110,691,033 - 110,701,546 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 109,901,030 - 109,908,498 (+) NCBI MGSCv36 mm8 Celera 12 110,648,411 - 110,658,915 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 60.17 NCBI
Dlk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955627 38,128 - 43,728 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955627 37,886 - 43,730 (-) NCBI ChiLan1.0 ChiLan1.0
DLK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 101,879,300 - 101,887,554 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 101,095,796 - 101,104,047 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 81,348,380 - 81,356,607 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 100,654,965 - 100,668,020 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 100,654,965 - 100,668,019 (+) Ensembl panpan1.1 panPan2
DLK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 68,961,975 - 68,970,106 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 68,961,744 - 68,972,761 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 68,479,790 - 68,487,872 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 69,245,619 - 69,253,709 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 69,245,491 - 69,256,384 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 68,906,950 - 68,915,034 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 68,973,041 - 68,981,107 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 69,370,948 - 69,379,035 (+) NCBI UU_Cfam_GSD_1.0
Dlk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 5,567,786 - 5,578,803 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936604 4,504,503 - 4,511,910 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936604 4,504,519 - 4,511,897 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DLK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 121,565,854 - 121,576,654 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 121,565,844 - 121,577,493 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 132,339,547 - 132,345,907 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DLK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 78,687,542 - 78,695,782 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 78,687,668 - 78,695,607 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 65,824,853 - 65,833,295 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dlk1
.
Predicted Target Of
Count of predictions: 81 Count of miRNA genes: 59 Interacting mature miRNAs: 63 Transcripts: ENSRNOT00000006339 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
BE115497
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 128,417,114 - 128,417,264 (+) MAPPER mRatBN7.2 Rnor_6.0 6 133,583,346 - 133,583,495 NCBI Rnor6.0 Rnor_5.0 6 142,748,927 - 142,749,076 UniSTS Rnor5.0 RGSC_v3.4 6 134,028,833 - 134,028,982 UniSTS RGSC3.4 Celera 6 125,967,189 - 125,967,338 UniSTS RH 3.4 Map 6 791.5 UniSTS Cytogenetic Map 6 q32 UniSTS
UniSTS:259449
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 128,416,706 - 128,417,270 (+) MAPPER mRatBN7.2 Rnor_6.0 6 133,582,938 - 133,583,501 NCBI Rnor6.0 Rnor_5.0 6 142,748,519 - 142,749,082 UniSTS Rnor5.0 RGSC_v3.4 6 134,028,425 - 134,028,988 UniSTS RGSC3.4 Celera 6 125,966,781 - 125,967,344 UniSTS Cytogenetic Map 6 q32 UniSTS
Dlk1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 128,416,794 - 128,417,010 (+) MAPPER mRatBN7.2 Rnor_6.0 6 133,583,026 - 133,583,241 NCBI Rnor6.0 Rnor_5.0 6 142,748,607 - 142,748,822 UniSTS Rnor5.0 RGSC_v3.4 6 134,028,513 - 134,028,728 UniSTS RGSC3.4 Celera 6 125,966,869 - 125,967,084 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
48
113
85
84
53
24
53
6
204
95
93
39
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006339 ⟹ ENSRNOP00000006339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 128,410,969 - 128,417,522 (+) Ensembl Rnor_6.0 Ensembl 6 133,552,821 - 133,583,498 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085933 ⟹ ENSRNOP00000069391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 128,410,316 - 128,417,522 (+) Ensembl Rnor_6.0 Ensembl 6 133,576,568 - 133,583,751 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107076 ⟹ ENSRNOP00000086145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 128,410,316 - 128,417,267 (+) Ensembl
RefSeq Acc Id:
NM_053744 ⟹ NP_446196
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 134,192,597 - 134,199,779 (+) NCBI mRatBN7.2 6 128,410,335 - 128,417,518 (+) NCBI Rnor_6.0 6 133,576,568 - 133,583,751 (+) NCBI Rnor_5.0 6 142,742,149 - 142,749,166 (+) NCBI RGSC_v3.4 6 134,022,016 - 134,043,058 (+) RGD Celera 6 125,960,411 - 125,967,475 (+) NCBI
Sequence:
CCCGGTGCAACCCTGGCTTTCTTTCCGCTGGACACCCGTGCCCCCTTCGTGGTCCGCAACCAGAAGCCCAGCGCAGCCCCGGAGCAGCCCCTGCACCGCCACCGCTACCCGGACCACGACCCAGGCCG
hide sequence
RefSeq Acc Id:
XM_008764917 ⟹ XP_008763139
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 134,192,491 - 134,199,777 (+) NCBI mRatBN7.2 6 128,410,216 - 128,417,397 (+) NCBI Rnor_6.0 6 133,576,513 - 133,583,742 (+) NCBI
Sequence:
GCGGCGCGCGGGCCGCAGCGGCAGCTCCTCGGCAGCCGCACTTAGTAGCGTGCGCCCCGGTGCA
hide sequence
RefSeq Acc Id:
XM_063261397 ⟹ XP_063117467
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 134,192,503 - 134,199,777 (+) NCBI
RefSeq Acc Id:
NP_446196 ⟸ NM_053744
- Peptide Label:
precursor
- UniProtKB:
Q62779 (UniProtKB/Swiss-Prot), O70534 (UniProtKB/TrEMBL), A6KBJ4 (UniProtKB/TrEMBL)
- Sequence:
MIATGALLRVLLLLLAFGHSTYGAECDPACDPQHGFCEADNVCRCEPGWEGPLCEKCVTSPGCVNGLCEEPWQCVCKEGWDGKFCEIDIRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKA
hide sequence
RefSeq Acc Id:
XP_008763139 ⟸ XM_008764917
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GDQ5 (UniProtKB/TrEMBL), A6KBJ4 (UniProtKB/TrEMBL)
- Sequence:
MIATGALLRVLLLLLAFGHSTYGAECDPACDPQHGFCEADNVCRCEPGWEGPLCEKCVTSPGCVNGLCEEPWQCVCKEGWDGKFCEIDIRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKA
hide sequence
Ensembl Acc Id:
ENSRNOP00000006339 ⟸ ENSRNOT00000006339
Ensembl Acc Id:
ENSRNOP00000069391 ⟸ ENSRNOT00000085933
Ensembl Acc Id:
ENSRNOP00000086145 ⟸ ENSRNOT00000107076
RefSeq Acc Id:
XP_063117467 ⟸ XM_063261397
- Peptide Label:
isoform X2
- UniProtKB:
A6KBJ4 (UniProtKB/TrEMBL)
RGD ID: 13694825 Promoter ID: EPDNEW_R5349 Type: single initiation site Name: Dlk1_1 Description: delta like non-canonical Notch ligand 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 133,576,535 - 133,576,595 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-20
Dlk1
delta like non-canonical Notch ligand 1
Dlk1
delta-like 1 homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Dlk1
delta-like 1 homolog (Drosophila)
delta-like homolog (Drosophila)
Name updated
1299863 APPROVED
2002-08-07
Dlk1
delta-like homolog (Drosophila)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
involved in both differentiation and growth of beta-cells
632566
