Symbol:
Tnfrsf11b
Name:
TNF receptor superfamily member 11B
RGD ID:
619802
Description:
Predicted to enable heparan sulfate binding activity. Involved in several processes, including negative regulation of bone resorption; negative regulation of odontogenesis of dentin-containing tooth; and response to estrogen. Located in extracellular space. Biomarker of congestive heart failure; myocarditis; and periapical periodontitis. Human ortholog(s) of this gene implicated in Paget's disease of bone; Paget's disease of bone 5; and osteoarthritis. Orthologous to human TNFRSF11B (TNF receptor superfamily member 11b); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH (20S)-ginsenoside Rg3; (S)-nicotine; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93568; Opg; Osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; tumor necrosis factor receptor superfamily, member 11b; tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TNFRSF11B (TNF receptor superfamily member 11b) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tnfrsf11b (tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tnfrsf11b (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TNFRSF11B (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TNFRSF11B (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnfrsf11b (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TNFRSF11B (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TNFRSF11B (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tnfrsf11b (TNF receptor superfamily member 11b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ALDH18A1 (aldehyde dehydrogenase 18 family member A1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Tnfrsf11b (tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TNFRSF11B (TNF receptor superfamily member 11b)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tnfrsf11b (tumor necrosis factor receptor superfamily, member 11b)
Alliance
DIOPT (Ensembl Compara|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rab21
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tnfrsf11b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 87,456,318 - 87,484,324 (-) NCBI GRCr8 mRatBN7.2 7 85,566,520 - 85,594,526 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 85,566,520 - 85,594,538 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 87,463,913 - 87,491,923 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 89,665,094 - 89,693,104 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 89,470,571 - 89,498,581 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 93,798,580 - 93,826,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 93,798,545 - 93,826,665 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 94,436,612 - 94,464,618 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 90,606,424 - 90,634,431 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 90,640,654 - 90,668,661 (-) NCBI Celera 7 82,388,596 - 82,416,602 (-) NCBI Celera Cytogenetic Map 7 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnfrsf11b Rat (-)-anisomycin multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Anisomycin inhibits the reaction [GHRL protein inhibits the reaction [Uranium results in decreased expression of and results in decreased secretion of TNFRSF11B protein]] CTD PMID:29477364 Tnfrsf11b Rat (20S)-ginsenoside Rg3 multiple interactions EXP 6480464 ginsenoside Rg3 inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] more ... CTD PMID:27387537 Tnfrsf11b Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of TNFRSF11B mRNA CTD PMID:29981921 Tnfrsf11b Rat (S)-nicotine multiple interactions EXP 6480464 Dihydro-beta-Erythroidine inhibits the reaction [Nicotine results in increased expression of TNFRSF11B mRNA] CTD PMID:29981921 Tnfrsf11b Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Tnfrsf11b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of TNFRSF11B mRNA CTD PMID:22937105 Tnfrsf11b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression EXP 6480464 o and p'-DDT analog results in decreased expression of TNFRSF11B mRNA CTD PMID:22937105 Tnfrsf11b Rat 1,2-dichloroethane decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TNFRSF11B mRNA CTD PMID:28960355 Tnfrsf11b Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of TNFRSF11B mRNA CTD PMID:27840820 Tnfrsf11b Rat 1,2-dimethylhydrazine multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TNFRSF11B mRNA] CTD PMID:22206623 Tnfrsf11b Rat 1,2-dimethylhydrazine increases expression ISO Tnfrsf11b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TNFRSF11B mRNA CTD PMID:22206623 Tnfrsf11b Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine affects expression ISO Tnfrsf11b (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:30529163 Tnfrsf11b Rat 17alpha-ethynylestradiol affects expression ISO Tnfrsf11b (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TNFRSF11B mRNA CTD PMID:17555576 Tnfrsf11b Rat 17beta-estradiol multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 4-(2-aminoethyl)benzenesulfonylfluoride inhibits the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of TNFRSF11B mRNA] more ... CTD PMID:17404688 more ... Tnfrsf11b Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TNFRSF11B mRNA CTD PMID:32145629 Tnfrsf11b Rat 17beta-estradiol decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Estradiol results in decreased expression of TNFRSF11B mRNA CTD PMID:16202921 more ... Tnfrsf11b Rat 17beta-estradiol increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Estradiol results in increased expression of TNFRSF11B mRNA and Estradiol results in increased expression of TNFRSF11B protein CTD PMID:19619570 and PMID:27576059 Tnfrsf11b Rat 17beta-estradiol affects expression ISO TNFRSF11B (Homo sapiens) 6480464 Estradiol affects the expression of TNFRSF11B mRNA CTD PMID:14699072 Tnfrsf11b Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Dihydrotestosterone results in decreased expression of TNFRSF11B protein CTD PMID:17189957 Tnfrsf11b Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Flutamide inhibits the reaction [Dihydrotestosterone results in decreased expression of TNFRSF11B protein] CTD PMID:17189957 Tnfrsf11b Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO TNFRSF11B (Homo sapiens) 6480464 2 more ... CTD PMID:22262711 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of TNFRSF11B mRNA and [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in decreased expression of TNFRSF11B mRNA CTD PMID:19619570 and PMID:19684285 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF11B mRNA CTD PMID:34747641 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO TNFRSF11B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF11B mRNA CTD PMID:31887333 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tnfrsf11b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF11B mRNA CTD PMID:21570461 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFRSF11B mRNA CTD PMID:19619570 more ... Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of TNFRSF11B mRNA and Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of TNFRSF11B mRNA] CTD PMID:16054899 and PMID:25975270 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFRSF11B mRNA CTD PMID:15972635 Tnfrsf11b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFRSF11B mRNA CTD PMID:19684285 Tnfrsf11b Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tnfrsf11b (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Tnfrsf11b Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Chondroitin Sulfates co-treated with Glucosamine co-treated with Cholecalciferol] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:17996099 Tnfrsf11b Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO TNFRSF11B (Homo sapiens) 6480464 3 more ... CTD PMID:22262711 and PMID:28351761 Tnfrsf11b Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:34256052 Tnfrsf11b Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of TNFRSF11B mRNA CTD PMID:28522335 Tnfrsf11b Rat 3-chloropropane-1,2-diol increases expression ISO TNFRSF11B (Homo sapiens) 6480464 alpha-Chlorohydrin results in increased expression of TNFRSF11B mRNA CTD PMID:28070108 Tnfrsf11b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of TNFRSF11B mRNA more ... CTD PMID:16054899 Tnfrsf11b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased expression of TNFRSF11B mRNA more ... CTD PMID:28628672 and PMID:31016361 Tnfrsf11b Rat 4,4'-diaminodiphenylmethane increases expression ISO Tnfrsf11b (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TNFRSF11B mRNA CTD PMID:18648102 Tnfrsf11b Rat 5-fluorouracil increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Fluorouracil results in increased expression of TNFRSF11B mRNA CTD PMID:16557594 Tnfrsf11b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TNFRSF11B mRNA CTD PMID:24780913 and PMID:25825206 Tnfrsf11b Rat aldehydo-D-glucosamine multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Chondroitin Sulfates co-treated with Glucosamine co-treated with Cholecalciferol] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:17996099 Tnfrsf11b Rat aldehydo-D-glucose decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Glucose results in decreased secretion of TNFRSF11B protein CTD PMID:19924377 Tnfrsf11b Rat aldehydo-D-glucose multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased secretion of TNFRSF11B protein] CTD PMID:19924377 Tnfrsf11b Rat alendronic acid multiple interactions EXP 6480464 Alendronate inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] and Alendronate inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B protein] CTD PMID:27387537 Tnfrsf11b Rat all-trans-retinoic acid decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Tretinoin results in decreased expression of TNFRSF11B mRNA CTD PMID:21934132 Tnfrsf11b Rat allopurinol decreases expression EXP 6480464 Allopurinol results in decreased expression of TNFRSF11B mRNA CTD PMID:37876353 Tnfrsf11b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TNFRSF11B mRNA CTD PMID:16483693 Tnfrsf11b Rat amsacrine increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Amsacrine results in increased expression of TNFRSF11B mRNA CTD PMID:11459812 Tnfrsf11b Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 pyrazolanthrone inhibits the reaction [Alprostadil results in increased secretion of TNFRSF11B protein] more ... CTD PMID:24333336 more ... Tnfrsf11b Rat antimycin A decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Antimycin A results in decreased expression of TNFRSF11B protein CTD PMID:21381053 Tnfrsf11b Rat aripiprazole multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Aripiprazole inhibits the reaction [Ozone results in increased expression of TNFRSF11B mRNA] CTD PMID:31476115 Tnfrsf11b Rat arsenite(3-) increases expression ISO TNFRSF11B (Homo sapiens) 6480464 arsenite results in increased expression of TNFRSF11B mRNA CTD PMID:31646340 Tnfrsf11b Rat arsenous acid increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TNFRSF11B mRNA CTD PMID:17530438 Tnfrsf11b Rat arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of TNFRSF11B mRNA CTD PMID:19730151 Tnfrsf11b Rat avobenzone multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 avobenzone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased expression of TNFRSF11B mRNA] and avobenzone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat benzo[a]pyrene decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TNFRSF11B mRNA CTD PMID:21569818 Tnfrsf11b Rat benzo[a]pyrene increases methylation ISO TNFRSF11B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TNFRSF11B promoter CTD PMID:27901495 Tnfrsf11b Rat benzo[a]pyrene increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TNFRSF11B mRNA CTD PMID:28351761 Tnfrsf11b Rat benzo[a]pyrene increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TNFRSF11B mRNA CTD PMID:22228805 Tnfrsf11b Rat beta-D-glucosamine multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Chondroitin Sulfates co-treated with Glucosamine co-treated with Cholecalciferol] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:17996099 Tnfrsf11b Rat bis(2-chloroethyl) sulfide increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Mustard Gas results in increased expression of TNFRSF11B protein CTD PMID:33491125 Tnfrsf11b Rat bis(2-ethylhexyl) phthalate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Diethylhexyl Phthalate promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNFRSF11B mRNA CTD PMID:24066056 more ... Tnfrsf11b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TNFRSF11B mRNA CTD PMID:33296240 Tnfrsf11b Rat bisphenol A increases expression ISO TNFRSF11B (Homo sapiens) 6480464 bisphenol A results in increased expression of TNFRSF11B mRNA CTD PMID:29718440 Tnfrsf11b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of TNFRSF11B mRNA CTD PMID:31129395 Tnfrsf11b Rat bisphenol A multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TNFRSF11B gene more ... CTD PMID:28628672 more ... Tnfrsf11b Rat bisphenol A decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 bisphenol A results in decreased expression of TNFRSF11B mRNA CTD PMID:27685785 Tnfrsf11b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TNFRSF11B mRNA CTD PMID:25181051 and PMID:32145629 Tnfrsf11b Rat bisphenol F multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TNFRSF11B mRNA CTD PMID:28628672 Tnfrsf11b Rat Butylbenzyl phthalate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 butylbenzyl phthalate promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat Butylbenzyl phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat Butylparaben multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 butylparaben promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat cadmium acetate increases expression EXP 6480464 cadmium acetate results in increased expression of TNFRSF11B mRNA CTD PMID:34897960 Tnfrsf11b Rat cadmium acetate multiple interactions EXP 6480464 puerarin promotes the reaction [cadmium acetate results in increased expression of TNFRSF11B mRNA] CTD PMID:34897960 Tnfrsf11b Rat cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of TNFRSF11B protein CTD PMID:23954550 Tnfrsf11b Rat cadmium atom increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Cadmium results in increased expression of TNFRSF11B mRNA CTD PMID:31646340 Tnfrsf11b Rat cadmium atom multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TNFRSF11B protein CTD PMID:31793751 Tnfrsf11b Rat cadmium dichloride multiple interactions EXP 6480464 Plant Extracts inhibits the reaction [Cadmium Chloride results in decreased expression of TNFRSF11B protein] more ... CTD PMID:23726800 and PMID:25656917 Tnfrsf11b Rat cadmium dichloride multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TNFRSF11B protein CTD PMID:31793751 Tnfrsf11b Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TNFRSF11B protein CTD PMID:23726800 and PMID:25656917 Tnfrsf11b Rat calciol decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Cholecalciferol results in decreased expression of TNFRSF11B mRNA CTD PMID:17008384 Tnfrsf11b Rat calciol multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Chondroitin Sulfates co-treated with Cholecalciferol] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:17996099 Tnfrsf11b Rat calciol increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Cholecalciferol results in increased expression of TNFRSF11B mRNA CTD PMID:17170073 Tnfrsf11b Rat calcitriol increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Calcitriol results in increased expression of TNFRSF11B mRNA CTD PMID:16813520 Tnfrsf11b Rat calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of TNFRSF11B protein CTD PMID:19092814 Tnfrsf11b Rat calcium atom multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 TNFRSF11B protein inhibits the reaction [IL11 protein results in increased abundance of Calcium] and TNFRSF11B protein inhibits the reaction [TNFSF11 protein results in increased abundance of Calcium] CTD PMID:12110441 Tnfrsf11b Rat calcium(0) multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 TNFRSF11B protein inhibits the reaction [IL11 protein results in increased abundance of Calcium] and TNFRSF11B protein inhibits the reaction [TNFSF11 protein results in increased abundance of Calcium] CTD PMID:12110441 Tnfrsf11b Rat cannabidiol decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Cannabidiol results in decreased expression of TNFRSF11B mRNA CTD PMID:27932991 Tnfrsf11b Rat cannabidiol multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Cannabidiol inhibits the reaction [TNF protein results in increased expression of TNFRSF11B mRNA] CTD PMID:31250491 Tnfrsf11b Rat carbamazepine affects expression ISO TNFRSF11B (Homo sapiens) 6480464 Carbamazepine affects the expression of TNFRSF11B mRNA CTD PMID:25979313 Tnfrsf11b Rat carbocyclic thromboxane A2 decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 thromboxane A2 and carbocyclic results in decreased expression of TNFRSF11B mRNA CTD PMID:18264100 Tnfrsf11b Rat carbon nanotube increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tnfrsf11b Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of TNFRSF11B mRNA CTD PMID:19395590 Tnfrsf11b Rat carmustine decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Carmustine results in decreased expression of TNFRSF11B mRNA CTD PMID:15980968 Tnfrsf11b Rat celecoxib decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Celecoxib results in decreased secretion of TNFRSF11B protein CTD PMID:19327236 Tnfrsf11b Rat celecoxib increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Celecoxib results in increased expression of TNFRSF11B mRNA CTD PMID:19327236 Tnfrsf11b Rat CGP 52608 multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TNFRSF11B gene] CTD PMID:28238834 Tnfrsf11b Rat chloroprene decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Chloroprene results in decreased expression of TNFRSF11B mRNA CTD PMID:23125180 Tnfrsf11b Rat chlorpyrifos increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TNFRSF11B mRNA CTD PMID:27737797 Tnfrsf11b Rat choline multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFRSF11B mRNA CTD PMID:20938992 Tnfrsf11b Rat chondroitin sulfate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Chondroitin Sulfates co-treated with Cholecalciferol] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:17996099 Tnfrsf11b Rat chondroitin sulfate increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Chondroitin Sulfates results in increased expression of TNFRSF11B protein CTD PMID:17996099 Tnfrsf11b Rat chromium(3+) trichloride multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [cobaltous chloride co-treated with chromic chloride] results in decreased expression of TNFRSF11B mRNA CTD PMID:25966675 Tnfrsf11b Rat chromium(3+) trichloride decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 chromic chloride results in decreased expression of TNFRSF11B mRNA CTD PMID:25966675 Tnfrsf11b Rat clothianidin decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 clothianidin results in decreased expression of TNFRSF11B mRNA CTD PMID:31626844 Tnfrsf11b Rat cobalt dichloride multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [cobaltous chloride co-treated with chromic chloride] results in decreased expression of TNFRSF11B mRNA CTD PMID:25966675 Tnfrsf11b Rat cobalt dichloride decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 cobaltous chloride results in decreased expression of TNFRSF11B mRNA CTD PMID:25966675 Tnfrsf11b Rat cocaine affects expression ISO Tnfrsf11b (Mus musculus) 6480464 Cocaine affects the expression of TNFRSF11B mRNA CTD PMID:15681117 Tnfrsf11b Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of TNFRSF11B mRNA CTD PMID:17476578 Tnfrsf11b Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of TNFRSF11B mRNA CTD PMID:29981921 Tnfrsf11b Rat corticosterone multiple interactions EXP 6480464 [Corticosterone co-treated with PTH protein] results in decreased expression of TNFRSF11B mRNA and Mifepristone inhibits the reaction [Corticosterone results in increased expression of TNFRSF11B mRNA] CTD PMID:17476578 and PMID:29981921 Tnfrsf11b Rat crocidolite asbestos increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of TNFRSF11B mRNA CTD PMID:25757056 Tnfrsf11b Rat cycloheximide multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in decreased expression of TNFRSF11B mRNA CTD PMID:19684285 Tnfrsf11b Rat cyclosporin A decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TNFRSF11B mRNA CTD PMID:20106945 and PMID:27989131 Tnfrsf11b Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TNFRSF11B mRNA CTD PMID:21865292 Tnfrsf11b Rat D-glucose multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased secretion of TNFRSF11B protein] CTD PMID:19924377 Tnfrsf11b Rat D-glucose decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Glucose results in decreased secretion of TNFRSF11B protein CTD PMID:19924377 Tnfrsf11b Rat daidzein multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [daidzein results in increased expression of TNFRSF11B mRNA] and Fulvestrant inhibits the reaction [daidzein results in increased expression of TNFRSF11B protein] CTD PMID:27576059 Tnfrsf11b Rat daidzein increases expression ISO TNFRSF11B (Homo sapiens) 6480464 daidzein results in increased expression of TNFRSF11B mRNA and daidzein results in increased expression of TNFRSF11B protein CTD PMID:27576059 Tnfrsf11b Rat DDE affects expression EXP 6480464 Dichlorodiphenyl Dichloroethylene affects the expression of TNFRSF11B mRNA CTD PMID:24576310 Tnfrsf11b Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of TNFRSF11B mRNA CTD PMID:30207508 Tnfrsf11b Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of TNFRSF11B mRNA CTD PMID:32207525 Tnfrsf11b Rat dexamethasone decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Dexamethasone results in decreased expression of TNFRSF11B mRNA and Dexamethasone results in decreased expression of TNFRSF11B protein CTD PMID:11855844 Tnfrsf11b Rat dexamethasone increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Dexamethasone results in increased expression of TNFRSF11B protein CTD PMID:30878453 Tnfrsf11b Rat dexamethasone decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Dexamethasone results in decreased expression of TNFRSF11B mRNA and Dexamethasone results in decreased expression of TNFRSF11B protein CTD PMID:24116280 and PMID:30878453 Tnfrsf11b Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of TNFRSF11B mRNA and Dexamethasone results in decreased expression of TNFRSF11B protein CTD PMID:27387537 and PMID:28363435 Tnfrsf11b Rat dexamethasone multiple interactions EXP 6480464 Alendronate inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] more ... CTD PMID:27387537 and PMID:28363435 Tnfrsf11b Rat dexamethasone multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of TNFRSF11B mRNA more ... CTD PMID:16054899 more ... Tnfrsf11b Rat dexamethasone multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:11855844 more ... Tnfrsf11b Rat diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of TNFRSF11B mRNA CTD PMID:19730151 Tnfrsf11b Rat diarsenic trioxide increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TNFRSF11B mRNA CTD PMID:17530438 Tnfrsf11b Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TNFRSF11B mRNA CTD PMID:21266533 Tnfrsf11b Rat dibutyl phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat diethyl malate affects expression ISO Tnfrsf11b (Mus musculus) 6480464 diethyl malate affects the expression of TNFRSF11B mRNA CTD PMID:24814887 Tnfrsf11b Rat diethyl phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat dihydro-beta-erythroidine multiple interactions EXP 6480464 Dihydro-beta-Erythroidine inhibits the reaction [Nicotine results in increased expression of TNFRSF11B mRNA] CTD PMID:29981921 Tnfrsf11b Rat diisobutyl phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat diisononyl phthalate multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of TNFRSF11B protein CTD PMID:38954831 Tnfrsf11b Rat dioscin increases expression ISO Tnfrsf11b (Mus musculus) 6480464 dioscin results in increased expression of TNFRSF11B mRNA CTD PMID:24742230 Tnfrsf11b Rat dioscin multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 fulvestrant inhibits the reaction [dioscin results in increased expression of TNFRSF11B mRNA] and LRP5 protein affects the reaction [dioscin results in increased expression of TNFRSF11B mRNA] CTD PMID:24742230 Tnfrsf11b Rat dioxygen decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of TNFRSF11B mRNA CTD PMID:20660070 Tnfrsf11b Rat disodium selenite decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of TNFRSF11B mRNA CTD PMID:18175754 Tnfrsf11b Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of TNFRSF11B mRNA CTD PMID:25152437 Tnfrsf11b Rat dorsomorphin multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tnfrsf11b Rat doxorubicin decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TNFRSF11B mRNA CTD PMID:29803840 Tnfrsf11b Rat doxorubicin increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Doxorubicin results in increased expression of TNFRSF11B mRNA CTD PMID:36227756 Tnfrsf11b Rat doxorubicin increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Doxorubicin results in increased expression of TNFRSF11B mRNA CTD PMID:30031762 Tnfrsf11b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TNFRSF11B mRNA CTD PMID:29391264 Tnfrsf11b Rat entinostat increases expression ISO TNFRSF11B (Homo sapiens) 6480464 entinostat results in increased expression of TNFRSF11B mRNA CTD PMID:26272509 Tnfrsf11b Rat ethanol multiple interactions EXP 6480464 Ethanol promotes the reaction [lead acetate results in decreased expression of TNFRSF11B protein] CTD PMID:23376407 Tnfrsf11b Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TNFRSF11B mRNA CTD PMID:27338645 Tnfrsf11b Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of TNFRSF11B protein CTD PMID:23376407 Tnfrsf11b Rat ethylparaben increases expression ISO TNFRSF11B (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of TNFRSF11B mRNA CTD PMID:37690743 Tnfrsf11b Rat etoposide increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Etoposide results in increased expression of TNFRSF11B mRNA CTD PMID:11459812 Tnfrsf11b Rat fenofibrate decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Fenofibrate results in decreased expression of TNFRSF11B mRNA CTD PMID:25572481 Tnfrsf11b Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of TNFRSF11B mRNA CTD PMID:30307764 Tnfrsf11b Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of TNFRSF11B mRNA CTD PMID:18035473 Tnfrsf11b Rat flutamide multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Flutamide inhibits the reaction [Dihydrotestosterone results in decreased expression of TNFRSF11B protein] CTD PMID:17189957 Tnfrsf11b Rat folic acid multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFRSF11B mRNA more ... CTD PMID:20938992 and PMID:22206623 Tnfrsf11b Rat fonofos increases methylation ISO TNFRSF11B (Homo sapiens) 6480464 Fonofos results in increased methylation of TNFRSF11B promoter CTD PMID:22847954 Tnfrsf11b Rat fulvestrant multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TNFRSF11B gene more ... CTD PMID:24771768 more ... Tnfrsf11b Rat fulvestrant increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Fulvestrant results in increased expression of TNFRSF11B mRNA CTD PMID:31646340 Tnfrsf11b Rat fulvestrant multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Fulvestrant inhibits the reaction [dioscin results in increased expression of TNFRSF11B mRNA] and Fulvestrant inhibits the reaction [naringenin-6-C-glucoside results in increased expression of TNFRSF11B mRNA] CTD PMID:21864313 and PMID:24742230 Tnfrsf11b Rat furan decreases expression EXP 6480464 furan results in decreased expression of TNFRSF11B mRNA CTD PMID:26194646 Tnfrsf11b Rat furan increases expression EXP 6480464 furan results in increased expression of TNFRSF11B mRNA CTD PMID:27387713 Tnfrsf11b Rat gadolinium trichloride increases expression ISO TNFRSF11B (Homo sapiens) 6480464 gadolinium chloride results in increased expression of TNFRSF11B mRNA CTD PMID:21605080 Tnfrsf11b Rat gemcitabine increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Gemcitabine results in increased expression of TNFRSF11B mRNA CTD PMID:17039268 Tnfrsf11b Rat genistein increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Genistein results in increased expression of TNFRSF11B mRNA CTD PMID:11459812 Tnfrsf11b Rat genistein decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Genistein results in decreased expression of TNFRSF11B mRNA CTD PMID:32186404 Tnfrsf11b Rat genistein increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Genistein results in increased expression of TNFRSF11B mRNA CTD PMID:15256057 Tnfrsf11b Rat glucose multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased secretion of TNFRSF11B protein] CTD PMID:19924377 Tnfrsf11b Rat glucose decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Glucose results in decreased secretion of TNFRSF11B protein CTD PMID:19924377 Tnfrsf11b Rat glycerol 2-phosphate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of TNFRSF11B mRNA and EZH2 protein inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of TNFRSF11B mRNA] CTD PMID:26424790 Tnfrsf11b Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of TNFRSF11B mRNA CTD PMID:24915197 Tnfrsf11b Rat glyphosate increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Glyphosate results in increased expression of TNFRSF11B mRNA CTD PMID:31874349 Tnfrsf11b Rat hydrogen peroxide affects expression ISO TNFRSF11B (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TNFRSF11B mRNA CTD PMID:20044591 Tnfrsf11b Rat hydrogen peroxide increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of TNFRSF11B protein CTD PMID:33491125 Tnfrsf11b Rat icariin multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 NOG protein inhibits the reaction [icariin results in increased expression of TNFRSF11B mRNA] CTD PMID:19747809 Tnfrsf11b Rat icariin increases expression ISO Tnfrsf11b (Mus musculus) 6480464 icariin results in increased expression of TNFRSF11B mRNA CTD PMID:19747809 Tnfrsf11b Rat icariside II increases expression EXP 6480464 baohuoside I results in increased expression of TNFRSF11B mRNA CTD PMID:17764702 Tnfrsf11b Rat Icaritin increases expression EXP 6480464 icaritin results in increased expression of TNFRSF11B mRNA CTD PMID:17764702 Tnfrsf11b Rat indometacin multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of TNFRSF11B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TNFRSF11B mRNA CTD PMID:28628672 Tnfrsf11b Rat iron dextran decreases expression EXP 6480464 Iron-Dextran Complex results in decreased expression of TNFRSF11B mRNA CTD PMID:29122540 Tnfrsf11b Rat isoflurane increases expression EXP 6480464 Isoflurane results in increased expression of TNFRSF11B mRNA CTD PMID:16978161 Tnfrsf11b Rat isonicotinamide increases expression ISO Tnfrsf11b (Mus musculus) 6480464 isonicotinamide results in increased expression of TNFRSF11B mRNA CTD PMID:16813520 Tnfrsf11b Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of TNFRSF11B mRNA CTD PMID:20080153 Tnfrsf11b Rat L-ascorbic acid decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Ascorbic Acid results in decreased expression of TNFRSF11B mRNA CTD PMID:17664058 Tnfrsf11b Rat L-ascorbic acid multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of TNFRSF11B mRNA and EZH2 protein inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of TNFRSF11B mRNA] CTD PMID:26424790 Tnfrsf11b Rat L-methionine multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TNFRSF11B mRNA CTD PMID:20938992 Tnfrsf11b Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of TNFRSF11B mRNA and lead acetate results in decreased expression of TNFRSF11B protein CTD PMID:22641619 and PMID:23376407 Tnfrsf11b Rat lead diacetate decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 lead acetate results in decreased expression of TNFRSF11B mRNA CTD PMID:30312686 Tnfrsf11b Rat lead diacetate multiple interactions EXP 6480464 Ethanol promotes the reaction [lead acetate results in decreased expression of TNFRSF11B protein] CTD PMID:23376407 Tnfrsf11b Rat leflunomide increases expression ISO Tnfrsf11b (Mus musculus) 6480464 leflunomide results in increased expression of TNFRSF11B mRNA CTD PMID:19751817 Tnfrsf11b Rat levonorgestrel increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Levonorgestrel results in increased expression of TNFRSF11B mRNA CTD PMID:16114553 Tnfrsf11b Rat lipopolysaccharide multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Triclosan inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF11B mRNA] CTD PMID:20507366 Tnfrsf11b Rat lipopolysaccharide multiple interactions EXP 6480464 Titanium promotes the reaction [Lipopolysaccharides results in decreased expression of TNFRSF11B protein] CTD PMID:25446332 Tnfrsf11b Rat lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of TNFRSF11B protein CTD PMID:25446332 Tnfrsf11b Rat lipopolysaccharide multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Titanium promotes the reaction [Lipopolysaccharides results in decreased expression of TNFRSF11B protein] CTD PMID:25446332 Tnfrsf11b Rat lipopolysaccharide decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of TNFRSF11B protein CTD PMID:25446332 Tnfrsf11b Rat lovastatin increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Lovastatin results in increased expression of TNFRSF11B mRNA CTD PMID:24742230 Tnfrsf11b Rat menadione increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of TNFRSF11B mRNA CTD PMID:19675304 Tnfrsf11b Rat menaquinone-4 increases expression ISO Tnfrsf11b (Mus musculus) 6480464 menatetrenone results in increased expression of TNFRSF11B mRNA CTD PMID:31173816 Tnfrsf11b Rat menaquinone-7 increases expression ISO Tnfrsf11b (Mus musculus) 6480464 menaquinone 7 results in increased expression of TNFRSF11B mRNA CTD PMID:31173816 Tnfrsf11b Rat methotrexate increases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Methotrexate results in increased secretion of TNFRSF11B protein CTD PMID:15593184 Tnfrsf11b Rat methotrexate multiple interactions EXP 6480464 Methotrexate inhibits the reaction [Freund's Adjuvant results in decreased expression of TNFRSF11B mRNA] CTD PMID:30025850 Tnfrsf11b Rat methylmercury chloride decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TNFRSF11B mRNA CTD PMID:28001369 Tnfrsf11b Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [CORT protein results in increased expression of TNFRSF11B mRNA] and Mifepristone inhibits the reaction [Corticosterone results in increased expression of TNFRSF11B mRNA] CTD PMID:27338645 and PMID:29981921 Tnfrsf11b Rat Myrtucommulone A decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 myrtucommulone A results in decreased expression of TNFRSF11B mRNA CTD PMID:26032814 Tnfrsf11b Rat N-methyl-N-nitrosourea decreases expression EXP 6480464 Methylnitrosourea results in decreased expression of TNFRSF11B mRNA CTD PMID:17341692 Tnfrsf11b Rat N-nitrosodiethylamine decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of TNFRSF11B mRNA CTD PMID:24535843 Tnfrsf11b Rat naringin multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 naringin inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B protein] and naringin inhibits the reaction [Dexamethasone results in increased expression of TNFRSF11B protein] CTD PMID:30878453 Tnfrsf11b Rat nickel atom increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Nickel results in increased expression of TNFRSF11B mRNA CTD PMID:24768652 and PMID:25583101 Tnfrsf11b Rat nicotinamide decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Niacinamide results in decreased expression of TNFRSF11B mRNA CTD PMID:16813520 Tnfrsf11b Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of TNFRSF11B mRNA CTD PMID:29981921 Tnfrsf11b Rat nicotine multiple interactions EXP 6480464 Dihydro-beta-Erythroidine inhibits the reaction [Nicotine results in increased expression of TNFRSF11B mRNA] CTD PMID:29981921 Tnfrsf11b Rat O-methyleugenol decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 methyleugenol results in decreased expression of TNFRSF11B mRNA CTD PMID:32234424 Tnfrsf11b Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of TNFRSF11B mRNA CTD PMID:23665939 Tnfrsf11b Rat ospemifene multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Ospemifene results in increased expression of and results in increased secretion of TNFRSF11B protein CTD PMID:17420779 Tnfrsf11b Rat ozagrel increases expression ISO TNFRSF11B (Homo sapiens) 6480464 ozagrel results in increased expression of TNFRSF11B mRNA CTD PMID:18264100 Tnfrsf11b Rat ozone increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Ozone results in increased expression of TNFRSF11B mRNA CTD PMID:31476115 Tnfrsf11b Rat ozone multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Aripiprazole inhibits the reaction [Ozone results in increased expression of TNFRSF11B mRNA] CTD PMID:31476115 Tnfrsf11b Rat p-menthan-3-ol decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Menthol results in decreased expression of TNFRSF11B mRNA CTD PMID:26760959 Tnfrsf11b Rat pamidronate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 pamidronate inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] and pamidronate inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B protein] CTD PMID:11855844 Tnfrsf11b Rat pamidronate increases expression ISO TNFRSF11B (Homo sapiens) 6480464 pamidronate results in increased expression of TNFRSF11B mRNA and pamidronate results in increased expression of TNFRSF11B protein CTD PMID:11855844 Tnfrsf11b Rat panobinostat multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFRSF11B mRNA CTD PMID:27188386 Tnfrsf11b Rat panobinostat increases expression ISO TNFRSF11B (Homo sapiens) 6480464 panobinostat results in increased expression of TNFRSF11B mRNA CTD PMID:26272509 Tnfrsf11b Rat paracetamol affects expression ISO Tnfrsf11b (Mus musculus) 6480464 Acetaminophen affects the expression of TNFRSF11B mRNA CTD PMID:17562736 Tnfrsf11b Rat paracetamol decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TNFRSF11B mRNA CTD PMID:21420995 more ... Tnfrsf11b Rat paraquat increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Paraquat results in increased expression of TNFRSF11B mRNA CTD PMID:18836921 Tnfrsf11b Rat parathion increases methylation ISO TNFRSF11B (Homo sapiens) 6480464 Parathion results in increased methylation of TNFRSF11B promoter CTD PMID:22847954 Tnfrsf11b Rat paricalcitol multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of TNFRSF11B mRNA and [Phosphorus co-treated with paricalcitol] results in decreased expression of TNFRSF11B protein CTD PMID:17715259 Tnfrsf11b Rat pentobarbital increases expression EXP 6480464 Pentobarbital results in increased expression of TNFRSF11B mRNA CTD PMID:16978161 Tnfrsf11b Rat perfluorononanoic acid decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of TNFRSF11B mRNA CTD PMID:32588087 Tnfrsf11b Rat perfluorooctane-1-sulfonic acid affects expression ISO TNFRSF11B (Homo sapiens) 6480464 perfluorooctane sulfonic acid affects the expression of TNFRSF11B mRNA CTD PMID:30738844 Tnfrsf11b Rat perfluorooctane-1-sulfonic acid decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of TNFRSF11B mRNA CTD PMID:32588087 Tnfrsf11b Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] CTD PMID:28363435 Tnfrsf11b Rat phenobarbital decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Phenobarbital results in decreased expression of TNFRSF11B mRNA CTD PMID:23091169 Tnfrsf11b Rat phenylmercury acetate increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TNFRSF11B mRNA CTD PMID:26272509 Tnfrsf11b Rat phenylmercury acetate multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFRSF11B mRNA CTD PMID:27188386 Tnfrsf11b Rat phosphorus atom multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of TNFRSF11B mRNA and [Phosphorus co-treated with paricalcitol] results in decreased expression of TNFRSF11B protein CTD PMID:17715259 Tnfrsf11b Rat phosphorus(.) multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of TNFRSF11B mRNA and [Phosphorus co-treated with paricalcitol] results in decreased expression of TNFRSF11B protein CTD PMID:17715259 Tnfrsf11b Rat pioglitazone multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Pioglitazone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat pirinixic acid decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 pirinixic acid results in decreased expression of TNFRSF11B mRNA CTD PMID:20813756 Tnfrsf11b Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TNFRSF11B mRNA CTD PMID:19162173 Tnfrsf11b Rat poly(ethylene) decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Polyethylene results in decreased expression of TNFRSF11B protein CTD PMID:15585240 Tnfrsf11b Rat poly(ethylene) decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Polyethylene results in decreased secretion of TNFRSF11B protein CTD PMID:15046894 Tnfrsf11b Rat potassium chromate increases expression ISO TNFRSF11B (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TNFRSF11B mRNA CTD PMID:22714537 Tnfrsf11b Rat potassium dichromate increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Potassium Dichromate results in increased expression of TNFRSF11B mRNA CTD PMID:23608068 Tnfrsf11b Rat progesterone multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 4-(2-aminoethyl)benzenesulfonylfluoride inhibits the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of TNFRSF11B mRNA] more ... CTD PMID:17404688 and PMID:20660070 Tnfrsf11b Rat progesterone decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Progesterone results in decreased expression of TNFRSF11B mRNA CTD PMID:17404688 and PMID:20660070 Tnfrsf11b Rat prostaglandin D2 increases secretion ISO Tnfrsf11b (Mus musculus) 6480464 Prostaglandin D2 results in increased secretion of TNFRSF11B protein CTD PMID:24813642 Tnfrsf11b Rat prostaglandin D2 increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Prostaglandin D2 results in increased expression of TNFRSF11B mRNA CTD PMID:24813642 Tnfrsf11b Rat prostaglandin D2 multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Prostaglandin D2 results in increased secretion of TNFRSF11B protein] more ... CTD PMID:24813642 Tnfrsf11b Rat prostaglandin E1 multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 pyrazolanthrone inhibits the reaction [Alprostadil results in increased secretion of TNFRSF11B protein] more ... CTD PMID:25677506 Tnfrsf11b Rat prostaglandin E1 increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Alprostadil results in increased expression of TNFRSF11B mRNA CTD PMID:25677506 Tnfrsf11b Rat prostaglandin E1 increases secretion ISO Tnfrsf11b (Mus musculus) 6480464 Alprostadil results in increased secretion of TNFRSF11B protein CTD PMID:25677506 Tnfrsf11b Rat prostaglandin E2 multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dinoprostone results in increased secretion of TNFRSF11B protein] more ... CTD PMID:25234201 Tnfrsf11b Rat prostaglandin E2 increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Dinoprostone results in increased expression of TNFRSF11B mRNA CTD PMID:25234201 Tnfrsf11b Rat prostaglandin E2 increases secretion ISO Tnfrsf11b (Mus musculus) 6480464 Dinoprostone results in increased secretion of TNFRSF11B protein CTD PMID:25234201 Tnfrsf11b Rat prostaglandin F2alpha multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dinoprost results in increased expression of and results in increased secretion of TNFRSF11B protein] more ... CTD PMID:24333336 Tnfrsf11b Rat prostaglandin F2alpha increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Dinoprost results in increased expression of TNFRSF11B mRNA CTD PMID:24333336 Tnfrsf11b Rat puerarin multiple interactions EXP 6480464 puerarin promotes the reaction [cadmium acetate results in increased expression of TNFRSF11B mRNA] CTD PMID:34897960 Tnfrsf11b Rat pyrethrins increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Pyrethrins results in increased expression of TNFRSF11B mRNA CTD PMID:35321623 Tnfrsf11b Rat quercetin increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Quercetin results in increased expression of TNFRSF11B mRNA CTD PMID:15309432 Tnfrsf11b Rat raloxifene multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in decreased expression of TNFRSF11B mRNA more ... CTD PMID:17420779 and PMID:19059307 Tnfrsf11b Rat raloxifene decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of TNFRSF11B mRNA CTD PMID:16005483 Tnfrsf11b Rat raloxifene increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of TNFRSF11B mRNA and Raloxifene Hydrochloride results in increased expression of TNFRSF11B protein CTD PMID:16787719 more ... Tnfrsf11b Rat resveratrol multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [Resveratrol inhibits the reaction [TNF protein results in increased expression of TNFRSF11B mRNA]] and Resveratrol inhibits the reaction [TNF protein results in increased expression of TNFRSF11B mRNA] CTD PMID:24771768 Tnfrsf11b Rat resveratrol multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 resveratrol inhibits the reaction [Alprostadil results in increased expression of TNFRSF11B mRNA] more ... CTD PMID:24333336 more ... Tnfrsf11b Rat resveratrol increases expression ISO Tnfrsf11b (Mus musculus) 6480464 resveratrol results in increased expression of TNFRSF11B mRNA CTD PMID:16813520 Tnfrsf11b Rat rotenone decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Rotenone results in decreased expression of TNFRSF11B mRNA and Rotenone results in decreased expression of TNFRSF11B protein CTD PMID:17651460 Tnfrsf11b Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TNFRSF11B mRNA CTD PMID:28374803 Tnfrsf11b Rat rotenone decreases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Rotenone results in decreased secretion of TNFRSF11B protein CTD PMID:17651460 Tnfrsf11b Rat rubiadin increases expression EXP 6480464 rubiadin results in increased expression of TNFRSF11B mRNA and rubiadin results in increased expression of TNFRSF11B protein CTD PMID:21945525 Tnfrsf11b Rat Sanggenon C increases expression ISO Tnfrsf11b (Mus musculus) 6480464 sanggenone C results in increased expression of TNFRSF11B mRNA CTD PMID:30217005 Tnfrsf11b Rat SB 203580 multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 SB 203580 inhibits the reaction [Alprostadil results in increased secretion of TNFRSF11B protein] more ... CTD PMID:24333336 more ... Tnfrsf11b Rat SB 203580 decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 SB 203580 results in decreased expression of TNFRSF11B mRNA CTD PMID:20660070 Tnfrsf11b Rat SB 203580 multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 SB 203580 inhibits the reaction [IL1B protein results in decreased expression of TNFRSF11B protein] and SB 203580 promotes the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of TNFRSF11B mRNA] CTD PMID:20660070 and PMID:22727857 Tnfrsf11b Rat SB 431542 multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tnfrsf11b Rat silicon dioxide decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of TNFRSF11B mRNA CTD PMID:23806026 and PMID:25895662 Tnfrsf11b Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of TNFRSF11B mRNA CTD PMID:32721576 Tnfrsf11b Rat simvastatin increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Simvastatin results in increased expression of TNFRSF11B mRNA CTD PMID:21431270 Tnfrsf11b Rat sodium arsenate multiple interactions EXP 6480464 [sodium arsenate co-treated with Sodium Fluoride] results in decreased expression of TNFRSF11B mRNA CTD PMID:17190191 Tnfrsf11b Rat sodium arsenate increases expression ISO Tnfrsf11b (Mus musculus) 6480464 sodium arsenate results in increased expression of TNFRSF11B mRNA CTD PMID:21795629 Tnfrsf11b Rat sodium arsenate decreases expression EXP 6480464 sodium arsenate results in decreased expression of TNFRSF11B mRNA CTD PMID:17190191 Tnfrsf11b Rat sodium arsenite increases expression ISO Tnfrsf11b (Mus musculus) 6480464 sodium arsenite results in increased expression of TNFRSF11B mRNA CTD PMID:32068019 Tnfrsf11b Rat sodium arsenite decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 sodium arsenite results in decreased expression of TNFRSF11B mRNA CTD PMID:37682722 Tnfrsf11b Rat sodium arsenite decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TNFRSF11B mRNA CTD PMID:34032870 and PMID:38568856 Tnfrsf11b Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of TNFRSF11B mRNA CTD PMID:17190191 and PMID:25132241 Tnfrsf11b Rat sodium fluoride increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Sodium Fluoride results in increased expression of TNFRSF11B protein CTD PMID:26862884 Tnfrsf11b Rat sodium fluoride decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of TNFRSF11B protein CTD PMID:29447955 and PMID:32156525 Tnfrsf11b Rat sodium fluoride multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 [PTH protein results in increased susceptibility to Sodium Fluoride] which results in decreased expression of TNFRSF11B protein more ... CTD PMID:26862884 more ... Tnfrsf11b Rat sodium fluoride increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Sodium Fluoride results in increased expression of TNFRSF11B mRNA CTD PMID:26339601 Tnfrsf11b Rat sodium fluoride multiple interactions EXP 6480464 [sodium arsenate co-treated with Sodium Fluoride] results in decreased expression of TNFRSF11B mRNA CTD PMID:17190191 Tnfrsf11b Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of TNFRSF11B mRNA CTD PMID:25617479 Tnfrsf11b Rat sulfasalazine increases secretion ISO TNFRSF11B (Homo sapiens) 6480464 Sulfasalazine results in increased secretion of TNFRSF11B protein CTD PMID:15593184 Tnfrsf11b Rat sunitinib decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Sunitinib results in decreased expression of TNFRSF11B mRNA CTD PMID:31533062 Tnfrsf11b Rat tacrolimus hydrate decreases expression EXP 6480464 Tacrolimus results in decreased expression of TNFRSF11B mRNA CTD PMID:21865292 Tnfrsf11b Rat tamoxifen multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR1 protein] results in decreased expression of TNFRSF11B mRNA more ... CTD PMID:17420779 and PMID:19059307 Tnfrsf11b Rat tamoxifen affects expression ISO Tnfrsf11b (Mus musculus) 6480464 Tamoxifen affects the expression of TNFRSF11B mRNA CTD PMID:17555576 Tnfrsf11b Rat telmisartan increases expression EXP 329956421 telmisartan increases expression of mRNA in mandible of WKY rats with periodontal disease RGD Tnfrsf11b Rat terbufos increases methylation ISO TNFRSF11B (Homo sapiens) 6480464 terbufos results in increased methylation of TNFRSF11B promoter CTD PMID:22847954 Tnfrsf11b Rat tetrachloromethane increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TNFRSF11B mRNA CTD PMID:31919559 Tnfrsf11b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TNFRSF11B mRNA CTD PMID:23411599 and PMID:34492290 Tnfrsf11b Rat titanium atom increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Titanium results in increased expression of TNFRSF11B mRNA CTD PMID:18449944 Tnfrsf11b Rat titanium atom multiple interactions EXP 6480464 Titanium promotes the reaction [Lipopolysaccharides results in decreased expression of TNFRSF11B protein] CTD PMID:25446332 Tnfrsf11b Rat titanium atom multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Titanium promotes the reaction [Lipopolysaccharides results in decreased expression of TNFRSF11B protein] CTD PMID:25446332 Tnfrsf11b Rat toluene increases expression EXP 6480464 Toluene results in increased expression of TNFRSF11B mRNA CTD PMID:22967744 Tnfrsf11b Rat tributylstannane multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 tributyltin promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] CTD PMID:31016361 Tnfrsf11b Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of TNFRSF11B mRNA CTD PMID:31129395 Tnfrsf11b Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of TNFRSF11B gene CTD PMID:27618143 Tnfrsf11b Rat trichostatin A decreases expression EXP 6480464 trichostatin A results in decreased expression of TNFRSF11B mRNA CTD PMID:23558232 Tnfrsf11b Rat trichostatin A multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFRSF11B mRNA CTD PMID:27188386 Tnfrsf11b Rat trichostatin A increases expression ISO TNFRSF11B (Homo sapiens) 6480464 trichostatin A results in increased expression of TNFRSF11B mRNA CTD PMID:24935251 and PMID:26272509 Tnfrsf11b Rat triclosan multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 Triclosan inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF11B mRNA] CTD PMID:20507366 Tnfrsf11b Rat trimellitic anhydride increases expression ISO Tnfrsf11b (Mus musculus) 6480464 trimellitic anhydride results in increased expression of TNFRSF11B mRNA CTD PMID:19042947 Tnfrsf11b Rat troglitazone decreases expression ISO Tnfrsf11b (Mus musculus) 6480464 troglitazone results in decreased expression of TNFRSF11B mRNA CTD PMID:16813520 Tnfrsf11b Rat troglitazone decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 troglitazone results in decreased expression of TNFRSF11B mRNA CTD PMID:25572481 Tnfrsf11b Rat uranium atom multiple interactions EXP 6480464 GHRL protein inhibits the reaction [Uranium results in decreased expression of and results in decreased secretion of TNFRSF11B protein] and Uranium results in decreased expression of and results in decreased secretion of TNFRSF11B protein CTD PMID:29477364 Tnfrsf11b Rat uranium atom multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 Anisomycin inhibits the reaction [GHRL protein inhibits the reaction [Uranium results in decreased expression of and results in decreased secretion of TNFRSF11B protein]] more ... CTD PMID:29477364 Tnfrsf11b Rat usnic acid increases expression ISO TNFRSF11B (Homo sapiens) 6480464 usnic acid results in increased expression of TNFRSF11B mRNA CTD PMID:32508146 Tnfrsf11b Rat valproic acid multiple interactions EXP 6480464 Fish Oils inhibits the reaction [Valproic Acid results in decreased expression of TNFRSF11B protein] and Propolis inhibits the reaction [Valproic Acid results in decreased expression of TNFRSF11B protein] CTD PMID:18455911 Tnfrsf11b Rat valproic acid decreases expression ISO TNFRSF11B (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TNFRSF11B mRNA CTD PMID:23179753 more ... Tnfrsf11b Rat valproic acid increases expression ISO TNFRSF11B (Homo sapiens) 6480464 Valproic Acid results in increased expression of TNFRSF11B mRNA CTD PMID:24383497 and PMID:24935251 Tnfrsf11b Rat valproic acid affects expression ISO TNFRSF11B (Homo sapiens) 6480464 Valproic Acid affects the expression of TNFRSF11B mRNA CTD PMID:25979313 Tnfrsf11b Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TNFRSF11B mRNA and Valproic Acid results in decreased expression of TNFRSF11B protein CTD PMID:18455911 and PMID:34779009 Tnfrsf11b Rat vorinostat multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFRSF11B mRNA CTD PMID:27188386 Tnfrsf11b Rat vorinostat increases expression ISO TNFRSF11B (Homo sapiens) 6480464 vorinostat results in increased expression of TNFRSF11B mRNA CTD PMID:26272509 Tnfrsf11b Rat zinc dichloride multiple interactions EXP 6480464 zinc chloride inhibits the reaction [Cadmium Chloride results in decreased expression of TNFRSF11B protein] CTD PMID:23726800 Tnfrsf11b Rat zoledronic acid affects expression ISO TNFRSF11B (Homo sapiens) 6480464 zoledronic acid affects the expression of TNFRSF11B protein CTD PMID:17041912 Tnfrsf11b Rat zoledronic acid multiple interactions ISO TNFRSF11B (Homo sapiens) 6480464 zoledronic acid inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B mRNA] and zoledronic acid inhibits the reaction [Dexamethasone results in decreased expression of TNFRSF11B protein] CTD PMID:11855844 Tnfrsf11b Rat zoledronic acid increases expression ISO TNFRSF11B (Homo sapiens) 6480464 zoledronic acid results in increased expression of TNFRSF11B mRNA and zoledronic acid results in increased expression of TNFRSF11B protein CTD PMID:11855844 more ... Tnfrsf11b Rat zoledronic acid increases secretion ISO TNFRSF11B (Homo sapiens) 6480464 zoledronic acid results in increased secretion of TNFRSF11B protein CTD PMID:14753746 Tnfrsf11b Rat zoledronic acid multiple interactions ISO Tnfrsf11b (Mus musculus) 6480464 TNFRSF11B protein affects the reaction [zoledronic acid results in decreased activity of ALPL protein] CTD PMID:18496637 Tnfrsf11b Rat zoledronic acid increases expression ISO Tnfrsf11b (Mus musculus) 6480464 Zoledronic Acid results in increased expression of TNFRSF11B mRNA and Zoledronic Acid results in increased expression of TNFRSF11B protein CTD PMID:16121404
Imported Annotations - KEGG (archival)
(-)-anisomycin (ISO) (20S)-ginsenoside Rg3 (EXP) (S)-nicotine (EXP) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-chloropropane-1,2-diol (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (ISO) alendronic acid (EXP) all-trans-retinoic acid (ISO) allopurinol (EXP) ammonium chloride (EXP) amsacrine (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antimycin A (ISO) aripiprazole (ISO) arsenite(3-) (ISO) arsenous acid (EXP,ISO) avobenzone (ISO) benzo[a]pyrene (ISO) beta-D-glucosamine (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) Butylparaben (ISO) cadmium acetate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) calciol (ISO) calcitriol (EXP,ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (ISO) carbamazepine (ISO) carbocyclic thromboxane A2 (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) carmustine (ISO) celecoxib (ISO) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) chondroitin sulfate (ISO) chromium(3+) trichloride (ISO) clothianidin (ISO) cobalt dichloride (ISO) cocaine (ISO) corticosterone (EXP) crocidolite asbestos (ISO) cycloheximide (ISO) cyclosporin A (EXP,ISO) D-glucose (ISO) daidzein (ISO) DDE (EXP) DDT (EXP) decabromodiphenyl ether (EXP) dexamethasone (EXP,ISO) diarsenic trioxide (EXP,ISO) dibutyl phthalate (EXP,ISO) diethyl malate (ISO) diethyl phthalate (ISO) dihydro-beta-erythroidine (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioscin (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (EXP) ethylparaben (ISO) etoposide (ISO) fenofibrate (ISO) fenvalerate (EXP) flavonoids (EXP) flutamide (ISO) folic acid (ISO) fonofos (ISO) fulvestrant (ISO) furan (EXP) gadolinium trichloride (ISO) gemcitabine (ISO) genistein (ISO) glucose (ISO) glycerol 2-phosphate (ISO) glycidol (EXP) glyphosate (ISO) hydrogen peroxide (ISO) icariin (ISO) icariside II (EXP) Icaritin (EXP) indometacin (ISO) iron dextran (EXP) isoflurane (EXP) isonicotinamide (ISO) ketamine (EXP) L-ascorbic acid (ISO) L-methionine (ISO) lead diacetate (EXP,ISO) leflunomide (ISO) levonorgestrel (ISO) lipopolysaccharide (EXP,ISO) lovastatin (ISO) menadione (ISO) menaquinone-4 (ISO) menaquinone-7 (ISO) methotrexate (EXP,ISO) methylmercury chloride (ISO) mifepristone (EXP) Myrtucommulone A (ISO) N-methyl-N-nitrosourea (EXP) N-nitrosodiethylamine (ISO) naringin (ISO) nickel atom (ISO) nicotinamide (ISO) nicotine (EXP) O-methyleugenol (ISO) orphenadrine (EXP) ospemifene (ISO) ozagrel (ISO) ozone (ISO) p-menthan-3-ol (ISO) pamidronate (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) paricalcitol (ISO) pentobarbital (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl caffeate (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) poly(ethylene) (ISO) potassium chromate (ISO) potassium dichromate (ISO) progesterone (ISO) prostaglandin D2 (ISO) prostaglandin E1 (ISO) prostaglandin E2 (ISO) prostaglandin F2alpha (ISO) puerarin (EXP) pyrethrins (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP,ISO) rubiadin (EXP) Sanggenon C (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) simvastatin (ISO) sodium arsenate (EXP,ISO) sodium arsenite (ISO) sodium fluoride (EXP,ISO) streptozocin (EXP) sulfasalazine (ISO) sunitinib (ISO) tacrolimus hydrate (EXP) tamoxifen (ISO) telmisartan (EXP) terbufos (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium atom (EXP,ISO) toluene (EXP) tributylstannane (EXP,ISO) trichloroethene (EXP) trichostatin A (EXP,ISO) triclosan (ISO) trimellitic anhydride (ISO) troglitazone (ISO) uranium atom (EXP,ISO) usnic acid (ISO) valproic acid (EXP,ISO) vorinostat (ISO) zinc dichloride (EXP) zoledronic acid (ISO)
1.
Calcium metabolism in adults with severe aortic valve stenosis and preserved renal function.
Akat K, etal., Am J Cardiol. 2010 Mar 15;105(6):862-4. doi: 10.1016/j.amjcard.2009.10.065.
2.
Decreased serum osteoprotegerin levels in patients with cardiac syndrome X.
Altun A, etal., J Endocrinol Invest. 2004 Oct;27(9):839-43.
3.
Markers of bone metastases in breast and lung cancers.
Bilgin E, etal., Asian Pac J Cancer Prev. 2012;13(9):4331-4.
4.
Osteoprotegerin is associated with cardiovascular risk in hypertension and/or diabetes.
Blazquez-Medela AM, etal., Eur J Clin Invest. 2012 May;42(5):548-56. doi: 10.1111/j.1365-2362.2011.02619.x. Epub 2011 Nov 4.
5.
Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.
Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
6.
Long-term sequential receptor activator of NF-kappaB ligand (RANKL) and osteoprotegrin (OPG) expression in lipopolysaccharide-induced rat periapical lesions.
Chuang FH, etal., J Oral Pathol Med. 2012 Feb;41(2):186-93. doi: 10.1111/j.1600-0714.2011.01065.x. Epub 2011 Jul 28.
7.
Reduced bone resorption and inflammation in apical periodontitis evoked by dietary supplementation with probiotics in rats.
Cosme-Silva L, etal., Int Endod J. 2020 Aug;53(8):1084-1092. doi: 10.1111/iej.13311. Epub 2020 May 21.
8.
Serum levels of osteoprotegerin and RANKL in patients with ST elevation acute myocardial infarction.
Crisafulli A, etal., Clin Sci (Lond). 2005 Oct;109(4):389-95.
9.
A mutation in the gene TNFRSF11B encoding osteoprotegerin causes an idiopathic hyperphosphatasia phenotype.
Cundy T, etal., Hum Mol Genet. 2002 Sep 1;11(18):2119-27.
10.
Imbalance of RANK, RANKL and OPG expression during tibial fracture repair in diabetic rats.
de Amorim FP, etal., J Mol Histol. 2008 Aug;39(4):401-8. Epub 2008 Jul 1.
11.
Correlations of urinary biomarkers, TNF-like weak inducer of apoptosis (TWEAK), osteoprotegerin (OPG), monocyte chemoattractant protein-1 (MCP-1), and IL-8 with lupus nephritis.
El-Shehaby A, etal., J Clin Immunol. 2011 Oct;31(5):848-56. doi: 10.1007/s10875-011-9555-1. Epub 2011 Jun 21.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Oral administration of a nonimmunosuppressant FKBP-12 ligand speeds nerve regeneration.
Gold BG, etal., Neuroreport. 1998 Feb 16;9(3):553-8.
14.
Early molecular responses of bone to obstructive nephropathy induced by unilateral ureteral obstruction in mice.
Gu SS, etal., Nephrology (Carlton). 2012 Nov;17(8):767-73. doi: 10.1111/j.1440-1797.2012.01656.x.
15.
Serum osteoprotegerin levels in patients with acute atherothrombotic stroke and lacunar infarct.
Guldiken B, etal., Thromb Res. 2007 Jan 24;.
16.
Osteoprotegerin concentrations and prognosis in acute ischaemic stroke.
Jensen JK, etal., J Intern Med. 2010 Apr;267(4):410-7. doi: 10.1111/j.1365-2796.2009.02163.x. Epub 2009 Aug 26.
17.
Combined effect of fluoride and arsenate on gene expression of osteoclast differentiation factor and osteoprotegerin.
Jia L and Jin TY, Biomed Environ Sci. 2006 Oct;19(5):375-9.
18.
Plasma osteoprotegerin levels predict cardiovascular and all-cause mortality and deterioration of kidney function in type 1 diabetic patients with nephropathy.
Jorsal A, etal., Diabetologia. 2008 Nov;51(11):2100-7. doi: 10.1007/s00125-008-1123-8. Epub 2008 Aug 22.
19.
Osteoprotegerin is a risk factor for progressive atherosclerosis and cardiovascular disease.
Kiechl S, etal., Circulation. 2004 May 11;109(18):2175-80. Epub 2004 Apr 26.
20.
Serum osteoprotegerin is a predictor of progression of atherosclerosis and coronary calcification in hemodialysis patients.
Kurnatowska I, etal., Nephron Clin Pract. 2011;117(4):c297-304. doi: 10.1159/000321169. Epub 2010 Sep 22.
21.
Sinomenine suppresses osteoclast formation and Mycobacterium tuberculosis H37Ra-induced bone loss by modulating RANKL signaling pathways.
Li X, etal., PLoS One. 2013 Sep 16;8(9):e74274. doi: 10.1371/journal.pone.0074274. eCollection 2013.
22.
[Serum osteoprotegerin level in children with nephrotic syndrome and the effect of glucocorticoid on it].
Li YL and Wang H, Zhongguo Dang Dai Er Ke Za Zhi. 2012 Sep;14(9):653-6.
23.
Osteoprotegerin/RANK/RANKL axis in cardiac remodeling due to immuno-inflammatory myocardial disease.
Liu W, etal., Exp Mol Pathol. 2008 Jun;84(3):213-7. Epub 2008 Mar 7.
24.
[Effects of kangfengshi granules on expressions of osteoprotegerin, RANKL and M-CSF in bone tissues of rats with collagen-induced arthritis]
Liu YH, etal., Zhong Xi Yi Jie He Xue Bao. 2006 May;4(3):307-10.
25.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
The RANKL/RANK/OPG signaling pathway mediates medial arterial calcification in diabetic Charcot neuroarthropathy.
Ndip A, etal., Diabetes. 2011 Aug;60(8):2187-96. doi: 10.2337/db10-1220. Epub 2011 Jun 9.
28.
Lovastatin raises serum osteoprotegerin level in people with type 2 diabetic nephropathy.
Nezami N, etal., Clin Biochem. 2010 Nov;43(16-17):1294-9. doi: 10.1016/j.clinbiochem.2010.08.012. Epub 2010 Aug 19.
29.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
30.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
31.
Icariin Prevents Diabetes-Induced Bone Loss in Rats by Reducing Blood Glucose and Suppressing Bone Turnover.
Qi S, etal., Molecules. 2019 May 15;24(10):1871. doi: 10.3390/molecules24101871.
32.
GOA pipeline
RGD automated data pipeline
33.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
34.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
35.
Comprehensive gene review and curation
RGD comprehensive gene curation
36.
Relationship of serum osteoprotegerin levels with coronary artery disease severity, left ventricular hypertrophy and C-reactive protein.
Rhee EJ, etal., Clin Sci (Lond). 2005 Mar;108(3):237-43.
37.
Osteoprotegerin reduces osteoclast numbers and prevents bone erosion in collagen-induced arthritis.
Romas E, etal., Am J Pathol 2002 Oct;161(4):1419-27.
38.
Effects of the RANKL inhibitor, osteoprotegerin, on the pain and histopathology of bone cancer in rats.
Roudier MP, etal., Clin Exp Metastasis. 2006;23(3-4):167-75. Epub 2006 Aug 16.
39.
Immunolocalization of RANKL is increased and OPG decreased during dietary magnesium deficiency in the rat.
Rude RK, etal., Nutr Metab (Lond). 2005 Sep 14;2(1):24.
40.
Osteoprotegerin: a novel secreted protein involved in the regulation of bone density.
Simonet WS, etal., Cell 1997 Apr 18;89(2):309-19.
41.
Prevalence and progression of peripheral vascular calcification in type 2 diabetes subjects with preserved kidney function.
Singh DK, etal., Diabetes Res Clin Pract. 2012 Jul;97(1):158-65. doi: 10.1016/j.diabres.2012.01.038. Epub 2012 Mar 3.
42.
Serum osteoprotegerin, RANKL and fibroblast growth factor-23 in children with chronic kidney disease.
Siomou E, etal., Pediatr Nephrol. 2011 Jul;26(7):1105-14. doi: 10.1007/s00467-011-1870-5. Epub 2011 Apr 9.
43.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
44.
Dysregulated osteoprotegerin/RANK ligand/RANK axis in clinical and experimental heart failure.
Ueland T, etal., Circulation. 2005 May 17;111(19):2461-8. Epub 2005 May 9.
45.
The relationship between insulin resistance assessed by HOMA-IR and serum osteoprotegerin levels in obesity.
Ugur-Altun B, etal., Diabetes Res Clin Pract. 2005 Jun;68(3):217-22. Epub 2005 Jan 18.
46.
Association study of candidate genes for the prevalence and progression of knee osteoarthritis.
Valdes AM, etal., Arthritis Rheum. 2004 Aug;50(8):2497-507.
47.
[Effect of estrogen on osteoprotegerin, osteoclast differentiation factor and macrophage colony stimulating factor mRNA expressions in ovariectomized rat bone tissue]
Wang Q, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2006 Apr;26(4):532-4.
48.
Zhong xi yi jie he xue bao = Journal of Chinese integrative medicine
Wang Q, etal., Zhong Xi Yi Jie He Xue Bao. 2006 May;4(3):303-6.
49.
Inhibition of osteoclastogenesis by the secretion of osteoprotegerin in vitro by rat dental follicle cells and its implications for tooth eruption.
Wise GE, etal., Arch Oral Biol 2002 Mar;47(3):247-54.
50.
Injections of osteoprotegerin and PMA delay tooth eruption.
Wise GE, etal., Clin Anat. 2006 Jan;19(1):19-24.
51.
Icariin Restores Bone Structure and Strength in a Rat Model of Chronic High-Dose Alcohol-Induced Osteopenia.
Wu JZ, etal., Cell Physiol Biochem. 2018;46(4):1727-1736. doi: 10.1159/000489248. Epub 2018 Apr 23.
52.
Protein Kinase C is a mediator of the synthesis and secretion of osteoprotegerin in osteoblast-like cells.
Yang X, etal., Biochem Biophys Res Commun 2002 Jan 11;290(1):42-6.
53.
[Indication of osteoprotegerin (OPG) and receptor activator of nuclear factor kappa B ligand (RANKL) in gingival crevicular fluid to remodeling of alveolar bone during retention].
Zhao NN, etal., Beijing Da Xue Xue Bao. 2012 Feb 18;44(1):108-12.
54.
Association between increased serum osteoprotegerin levels and improvement in bone mineral density after parathyroidectomy in hemodialysis patients.
Zheng CM, etal., Tohoku J Exp Med. 2012;226(1):19-27.
55.
Osteoprotegerin plasma concentrations correlate with severity of peripheral artery disease.
Ziegler S, etal., Atherosclerosis. 2005 Sep;182(1):175-80. Epub 2005 Apr 26.
Tnfrsf11b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 87,456,318 - 87,484,324 (-) NCBI GRCr8 mRatBN7.2 7 85,566,520 - 85,594,526 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 85,566,520 - 85,594,538 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 87,463,913 - 87,491,923 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 89,665,094 - 89,693,104 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 89,470,571 - 89,498,581 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 93,798,580 - 93,826,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 93,798,545 - 93,826,665 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 94,436,612 - 94,464,618 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 90,606,424 - 90,634,431 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 90,640,654 - 90,668,661 (-) NCBI Celera 7 82,388,596 - 82,416,602 (-) NCBI Celera Cytogenetic Map 7 q32 NCBI
TNFRSF11B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 118,923,557 - 118,951,885 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 118,923,557 - 118,951,885 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 119,935,796 - 119,964,124 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 120,004,977 - 120,033,564 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 120,004,977 - 120,033,492 NCBI Celera 8 116,124,073 - 116,152,621 (-) NCBI Celera Cytogenetic Map 8 q24.12 NCBI HuRef 8 115,263,331 - 115,291,874 (-) NCBI HuRef CHM1_1 8 119,976,820 - 120,005,398 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 120,051,990 - 120,080,310 (-) NCBI T2T-CHM13v2.0
Tnfrsf11b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 54,114,014 - 54,141,700 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 54,114,015 - 54,141,880 (-) Ensembl GRCm39 Ensembl GRCm38 15 54,250,619 - 54,278,484 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 54,250,619 - 54,278,484 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 54,082,174 - 54,110,039 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 54,080,702 - 54,108,567 (-) NCBI MGSCv36 mm8 Celera 15 55,801,719 - 55,829,545 (-) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 21.15 NCBI
Tnfrsf11b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 24,804,664 - 24,831,894 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 24,804,708 - 24,831,338 (-) NCBI ChiLan1.0 ChiLan1.0
TNFRSF11B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 136,349,949 - 136,380,083 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 111,861,966 - 111,890,819 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 115,614,778 - 115,643,387 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 118,134,305 - 118,162,422 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 118,134,305 - 118,162,422 (-) Ensembl panpan1.1 panPan2
TNFRSF11B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 18,155,765 - 18,183,263 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 18,156,367 - 18,183,444 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 18,157,696 - 18,185,164 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 18,475,888 - 18,503,357 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 18,475,887 - 18,503,320 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 18,206,469 - 18,233,953 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 18,302,728 - 18,330,220 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 18,533,442 - 18,560,917 (-) NCBI UU_Cfam_GSD_1.0
Tnfrsf11b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 20,145,169 - 20,172,626 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 27,571,270 - 27,599,089 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 27,571,263 - 27,598,725 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TNFRSF11B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 19,850,350 - 19,879,125 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 19,850,212 - 19,879,132 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 21,129,878 - 21,158,557 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TNFRSF11B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 113,520,711 - 113,549,370 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 113,520,596 - 113,548,936 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 26,748,455 - 26,777,113 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnfrsf11b
.
Predicted Target Of
Count of predictions: 184 Count of miRNA genes: 127 Interacting mature miRNAs: 156 Transcripts: ENSRNOT00000011344 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Hmgc3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 85,567,754 - 85,567,922 (+) MAPPER mRatBN7.2 Rnor_6.0 7 93,799,815 - 93,799,982 NCBI Rnor6.0 Rnor_5.0 7 94,437,847 - 94,438,014 UniSTS Rnor5.0 RGSC_v3.4 7 90,607,659 - 90,607,826 UniSTS RGSC3.4 Celera 7 82,389,831 - 82,389,998 UniSTS RH 3.4 Map 7 592.1 UniSTS RH 3.4 Map 7 592.1 RGD Cytogenetic Map 7 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011344 ⟹ ENSRNOP00000011344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 85,566,520 - 85,594,519 (-) Ensembl Rnor_6.0 Ensembl 7 93,798,545 - 93,826,665 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096742 ⟹ ENSRNOP00000094946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 85,566,523 - 85,594,538 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102998 ⟹ ENSRNOP00000086232
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 85,566,520 - 85,576,400 (-) Ensembl
RefSeq Acc Id:
NM_012870 ⟹ NP_037002
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 87,456,318 - 87,484,324 (-) NCBI mRatBN7.2 7 85,566,520 - 85,594,526 (-) NCBI Rnor_6.0 7 93,798,580 - 93,826,586 (-) NCBI Rnor_5.0 7 94,436,612 - 94,464,618 (-) NCBI RGSC_v3.4 7 90,606,424 - 90,634,431 (-) RGD Celera 7 82,388,596 - 82,416,602 (-) RGD
Sequence:
TCCTGTTGCCCAGACCTTATATAAAACGTCATGTTCGCCTGGGCAGCAGAGAAGCACCTAGCACTGGCCCAGCGGCTGCCGCCTGAGGTTTCCAGAGGACCACAATGAACAAGTGGCTGTGCTGTGCA
hide sequence
RefSeq Acc Id:
NP_037002 ⟸ NM_012870
- Peptide Label:
precursor
- UniProtKB:
O08727 (UniProtKB/Swiss-Prot), A6HRF7 (UniProtKB/TrEMBL), A0A8I6A1T0 (UniProtKB/TrEMBL)
- Sequence:
MNKWLCCALLVFLDIIEWTTQETFPPKYLHYDPETGRQLLCDKCAPGTYLKQHCTVRRKTLCVPCPDYSYTDSWHTSDECVYCSPVCKELQTVKQECNRTHNRVCECEEGRYLELEFCLKHRSCPPGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000011344 ⟸ ENSRNOT00000011344
Ensembl Acc Id:
ENSRNOP00000086232 ⟸ ENSRNOT00000102998
Ensembl Acc Id:
ENSRNOP00000094946 ⟸ ENSRNOT00000096742
RGD ID: 13695327 Promoter ID: EPDNEW_R5852 Type: multiple initiation site Name: Tnfrsf11b_1 Description: TNF receptor superfamily member 11B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 93,826,539 - 93,826,599 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-05
Tnfrsf11b
TNF receptor superfamily member 11B
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin)
tumor necrosis factor receptor superfamily, member 11b
Symbol and Name updated
625702 APPROVED
2003-04-09
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b
Symbol and Name updated
629477 APPROVED
2003-03-12
Tnfrsf11b
tumor necrosis factor receptor superfamily, member 11b
Opg
Osteoprotegerin
Data merged from RGD:3232
628472 PROVISIONAL
2002-08-07
Tnfrsf11b
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Opg
Osteoprotegerin
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
prevents ovariectomy-induced bone loss
730033
gene_expression
expressed as dimeric forms of 112 kDa and 56 kDa in osteoblasts, osteocytes, and osteoprogenitor cells
70599
gene_function
binds to the receptor activator of NF-KB ligand [RANKL] thus preventing the interaction with receptor activator of NF-KB [RANK]
70599
gene_process
may play a role in preventing excess bone resorption during dental follicle development
730196
gene_regulation
phorbol myristate acetate [PMA], an activator of protein kinase C [PKC], increased expression in a time and concentration dependent manner and this increase was blocked by bisindolyl maleimide [BIM], a protein kinase C inhibitor
70599
