Symbol:
Fmod
Name:
fibromodulin
RGD ID:
619769
Description:
Involved in skin development. Located in collagen-containing extracellular matrix and extracellular region. Biomarker of tendinitis. Orthologous to human FMOD (fibromodulin); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
collagen-binding 59 kDa protein; FM; keratan sulfate proteoglycan fibromodulin; KSPG fibromodulin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FMOD (fibromodulin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fmod (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fmod (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FMOD (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FMOD (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fmod (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FMOD (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FMOD (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fmod (fibromodulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Fmod (fibromodulin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FMOD (fibromodulin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fmoda (fibromodulin a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fmodb (fibromodulin b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
fmod
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Bp397
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 48,045,567 - 48,056,184 (+) NCBI GRCr8 mRatBN7.2 13 45,493,517 - 45,504,134 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 45,493,517 - 45,504,133 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 48,101,962 - 48,112,556 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 49,390,009 - 49,400,605 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 46,654,575 - 46,665,165 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 50,874,886 - 50,885,503 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 50,873,605 - 50,885,563 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 55,927,583 - 55,939,041 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 46,987,714 - 46,998,331 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 47,001,756 - 47,012,373 (+) NCBI Celera 13 45,822,144 - 45,832,470 (+) NCBI Celera RH 3.4 Map 13 184.4 RGD Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fmod Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of FMOD mRNA CTD PMID:21058326 Fmod Rat 17beta-estradiol decreases expression ISO Fmod (Mus musculus) 6480464 Estradiol results in decreased expression of FMOD mRNA CTD PMID:12469912 and PMID:39298647 Fmod Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FMOD mRNA CTD PMID:32145629 Fmod Rat 17beta-estradiol multiple interactions ISO FMOD (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of FMOD mRNA CTD PMID:30165855 Fmod Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO FMOD (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Fmod Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO FMOD (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of FMOD mRNA CTD PMID:20106945 and PMID:21632981 Fmod Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FMOD mRNA CTD PMID:33387578 Fmod Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FMOD mRNA CTD PMID:34747641 Fmod Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fmod (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FMOD mRNA CTD PMID:33956508 Fmod Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Fmod (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Fmod Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Fmod Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Fmod (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of FMOD mRNA CTD PMID:25172293 Fmod Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO FMOD (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of FMOD protein CTD PMID:31675489 Fmod Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FMOD (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FMOD mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of FMOD mRNA CTD PMID:28628672 Fmod Rat 3-methylcholanthrene decreases expression ISO Fmod (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of FMOD mRNA CTD PMID:20713471 Fmod Rat 4,4'-sulfonyldiphenol increases expression ISO Fmod (Mus musculus) 6480464 bisphenol S results in increased expression of FMOD mRNA CTD PMID:30951980 Fmod Rat 4,4'-sulfonyldiphenol affects methylation ISO Fmod (Mus musculus) 6480464 bisphenol S affects the methylation of FMOD gene CTD PMID:31683443 Fmod Rat 4-hydroxyphenyl retinamide increases expression ISO Fmod (Mus musculus) 6480464 Fenretinide results in increased expression of FMOD mRNA CTD PMID:28973697 Fmod Rat 4-hydroxyphenyl retinamide decreases expression ISO Fmod (Mus musculus) 6480464 Fenretinide results in decreased expression of FMOD mRNA CTD PMID:28973697 Fmod Rat 5-fluorouracil multiple interactions ISO FMOD (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in increased expression of FMOD mRNA] CTD PMID:15016801 Fmod Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of FMOD mRNA CTD PMID:24780913 Fmod Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FMOD mRNA CTD PMID:30047161 Fmod Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of FMOD mRNA CTD PMID:31881176 Fmod Rat aflatoxin B1 increases methylation ISO FMOD (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of FMOD gene CTD PMID:27153756 Fmod Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FMOD mRNA CTD PMID:35163327 Fmod Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of FMOD mRNA CTD PMID:30047161 Fmod Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FMOD mRNA CTD PMID:16483693 Fmod Rat arsenous acid decreases expression ISO FMOD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of FMOD mRNA CTD PMID:26705709 Fmod Rat arsenous acid decreases expression ISO Fmod (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of FMOD mRNA CTD PMID:35676786 Fmod Rat Azoxymethane multiple interactions ISO Fmod (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMOD mRNA CTD PMID:29950665 Fmod Rat benzo[a]pyrene decreases expression ISO Fmod (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FMOD mRNA CTD PMID:20713471 Fmod Rat benzo[a]pyrene increases methylation ISO FMOD (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FMOD exon and Benzo(a)pyrene results in increased methylation of FMOD promoter CTD PMID:27901495 Fmod Rat benzo[a]pyrene increases expression ISO FMOD (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of FMOD mRNA CTD PMID:21871943 and PMID:22316170 Fmod Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FMOD mRNA CTD PMID:25181051 more ... Fmod Rat bisphenol A decreases expression ISO FMOD (Homo sapiens) 6480464 bisphenol A results in decreased expression of FMOD protein CTD PMID:31675489 Fmod Rat bisphenol A increases expression ISO Fmod (Mus musculus) 6480464 bisphenol A results in increased expression of FMOD mRNA CTD PMID:30951980 and PMID:32156529 Fmod Rat bisphenol A multiple interactions ISO FMOD (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FMOD gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FMOD mRNA CTD PMID:28628672 and PMID:31601247 Fmod Rat bisphenol A decreases expression ISO Fmod (Mus musculus) 6480464 bisphenol A results in decreased expression of FMOD mRNA CTD PMID:25594700 Fmod Rat bisphenol F multiple interactions ISO FMOD (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of FMOD mRNA CTD PMID:28628672 Fmod Rat bisphenol F increases expression ISO Fmod (Mus musculus) 6480464 bisphenol F results in increased expression of FMOD mRNA CTD PMID:30951980 Fmod Rat butanal increases expression ISO FMOD (Homo sapiens) 6480464 butyraldehyde results in increased expression of FMOD mRNA CTD PMID:26079696 Fmod Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of FMOD mRNA CTD PMID:20349343 Fmod Rat carbon nanotube decreases expression ISO Fmod (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of FMOD mRNA CTD PMID:25554681 Fmod Rat CGP 52608 multiple interactions ISO FMOD (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FMOD gene] CTD PMID:28238834 Fmod Rat chlordecone affects expression ISO Fmod (Mus musculus) 6480464 Chlordecone affects the expression of FMOD mRNA CTD PMID:33711761 Fmod Rat cisplatin affects response to substance ISO FMOD (Homo sapiens) 6480464 FMOD protein affects the susceptibility to Cisplatin CTD PMID:16217747 Fmod Rat cobalt atom multiple interactions ISO FMOD (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of FMOD mRNA CTD PMID:18078969 Fmod Rat crocidolite asbestos increases expression ISO Fmod (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of FMOD mRNA CTD PMID:29279043 Fmod Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FMOD mRNA CTD PMID:26577399 Fmod Rat decabromodiphenyl ether increases expression ISO FMOD (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of FMOD protein CTD PMID:31675489 Fmod Rat deoxynivalenol decreases expression ISO FMOD (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of FMOD mRNA CTD PMID:31863870 Fmod Rat dexamethasone multiple interactions ISO FMOD (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FMOD mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of FMOD mRNA CTD PMID:28628672 Fmod Rat dextran sulfate multiple interactions ISO Fmod (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMOD mRNA CTD PMID:29950665 Fmod Rat diarsenic trioxide decreases expression ISO FMOD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of FMOD mRNA CTD PMID:26705709 Fmod Rat diarsenic trioxide decreases expression ISO Fmod (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of FMOD mRNA CTD PMID:35676786 Fmod Rat diazepam decreases expression ISO FMOD (Homo sapiens) 6480464 Diazepam results in decreased expression of FMOD mRNA CTD PMID:19114084 Fmod Rat diclofenac decreases expression ISO Fmod (Mus musculus) 6480464 Diclofenac results in decreased expression of FMOD mRNA CTD PMID:26934552 Fmod Rat diethylstilbestrol decreases expression ISO Fmod (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of FMOD mRNA CTD PMID:15171707 Fmod Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of FMOD mRNA CTD PMID:36653537 Fmod Rat dioxygen multiple interactions ISO Fmod (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FMOD mRNA CTD PMID:30529165 Fmod Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of FMOD mRNA CTD PMID:21551480 and PMID:25152437 Fmod Rat dorsomorphin multiple interactions ISO FMOD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FMOD mRNA CTD PMID:27188386 Fmod Rat doxorubicin decreases expression ISO Fmod (Mus musculus) 6480464 Doxorubicin results in decreased expression of FMOD mRNA CTD PMID:19073829 Fmod Rat doxorubicin affects expression ISO FMOD (Homo sapiens) 6480464 Doxorubicin affects the expression of FMOD mRNA CTD PMID:29803840 Fmod Rat entinostat increases expression ISO FMOD (Homo sapiens) 6480464 entinostat results in increased expression of FMOD mRNA CTD PMID:27188386 Fmod Rat ethylparaben decreases expression ISO FMOD (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of FMOD mRNA CTD PMID:37690743 Fmod Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of FMOD mRNA CTD PMID:17033635 Fmod Rat fulvestrant multiple interactions ISO FMOD (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FMOD gene CTD PMID:31601247 Fmod Rat furan increases expression EXP 6480464 furan results in increased expression of FMOD mRNA CTD PMID:27387713 Fmod Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FMOD mRNA CTD PMID:22061828 and PMID:33387578 Fmod Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of FMOD mRNA CTD PMID:24915197 Fmod Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of FMOD mRNA CTD PMID:24395379 Fmod Rat hydrogen peroxide affects expression ISO FMOD (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of FMOD mRNA CTD PMID:20044591 Fmod Rat indometacin multiple interactions ISO FMOD (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FMOD mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of FMOD mRNA CTD PMID:28628672 Fmod Rat inulin multiple interactions ISO Fmod (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FMOD mRNA CTD PMID:36331819 Fmod Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of FMOD mRNA CTD PMID:30047161 Fmod Rat methotrexate affects response to substance ISO FMOD (Homo sapiens) 6480464 FMOD protein affects the susceptibility to Methotrexate CTD PMID:16217747 Fmod Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FMOD gene CTD PMID:35440735 Fmod Rat microcystin-LR increases expression ISO Fmod (Mus musculus) 6480464 cyanoginosin LR results in increased expression of FMOD mRNA CTD PMID:37342990 Fmod Rat monosodium L-glutamate increases expression ISO Fmod (Mus musculus) 6480464 Sodium Glutamate results in increased expression of FMOD mRNA CTD PMID:19001666 Fmod Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FMOD mRNA CTD PMID:33387578 Fmod Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of FMOD mRNA CTD PMID:32680482 Fmod Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fmod (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FMOD mRNA CTD PMID:36331819 Fmod Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FMOD mRNA CTD PMID:35163327 Fmod Rat phenytoin decreases expression ISO FMOD (Homo sapiens) 6480464 Phenytoin results in decreased expression of FMOD mRNA CTD PMID:14741686 Fmod Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of FMOD mRNA CTD PMID:30047161 Fmod Rat PRIM-O-GLUCOSYLCIMIFUGIN increases expression EXP 6480464 prim-O-glucosylcimifugin results in increased expression of FMOD protein CTD PMID:37872152 Fmod Rat propanal increases expression ISO FMOD (Homo sapiens) 6480464 propionaldehyde results in increased expression of FMOD mRNA CTD PMID:26079696 Fmod Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of FMOD mRNA CTD PMID:27900601 Fmod Rat SB 431542 multiple interactions ISO FMOD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FMOD mRNA CTD PMID:27188386 Fmod Rat silicon dioxide decreases expression ISO FMOD (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of FMOD mRNA CTD PMID:25895662 Fmod Rat silver atom decreases expression ISO Fmod (Mus musculus) 6480464 Silver results in decreased expression of FMOD mRNA CTD PMID:27131904 Fmod Rat silver(0) decreases expression ISO Fmod (Mus musculus) 6480464 Silver results in decreased expression of FMOD mRNA CTD PMID:27131904 Fmod Rat sodium arsenite increases expression ISO Fmod (Mus musculus) 6480464 sodium arsenite results in increased expression of FMOD mRNA CTD PMID:37682722 Fmod Rat sodium arsenite decreases expression ISO FMOD (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FMOD mRNA CTD PMID:35954277 Fmod Rat sodium fluoride decreases expression ISO Fmod (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of FMOD protein CTD PMID:28918527 Fmod Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of FMOD protein CTD PMID:29653260 Fmod Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of FMOD mRNA CTD PMID:30047161 Fmod Rat T-2 toxin decreases expression ISO FMOD (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of FMOD mRNA CTD PMID:31863870 Fmod Rat tetrachloromethane increases expression ISO Fmod (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FMOD mRNA CTD PMID:17484886 Fmod Rat titanium dioxide affects expression ISO Fmod (Mus musculus) 6480464 titanium dioxide affects the expression of FMOD mRNA CTD PMID:23557971 Fmod Rat titanium dioxide multiple interactions ISO Fmod (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMOD mRNA CTD PMID:29950665 Fmod Rat titanium dioxide decreases expression ISO Fmod (Mus musculus) 6480464 titanium dioxide results in decreased expression of FMOD mRNA CTD PMID:29264374 Fmod Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of FMOD gene CTD PMID:27618143 Fmod Rat trimellitic anhydride decreases expression ISO Fmod (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of FMOD mRNA CTD PMID:19042947 Fmod Rat Tungsten carbide multiple interactions ISO FMOD (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of FMOD mRNA CTD PMID:18078969 Fmod Rat urethane decreases expression ISO FMOD (Homo sapiens) 6480464 Urethane results in decreased expression of FMOD mRNA CTD PMID:28818685 Fmod Rat valproic acid affects expression ISO FMOD (Homo sapiens) 6480464 Valproic Acid affects the expression of FMOD mRNA CTD PMID:25979313 Fmod Rat valproic acid increases expression ISO FMOD (Homo sapiens) 6480464 Valproic Acid results in increased expression of FMOD mRNA CTD PMID:26272509 and PMID:27188386 Fmod Rat valproic acid multiple interactions ISO FMOD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FMOD mRNA CTD PMID:27188386
1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsenous acid (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) capsaicin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) cisplatin (ISO) cobalt atom (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazepam (ISO) diclofenac (ISO) diethylstilbestrol (EXP,ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethylparaben (ISO) fluoxetine (EXP) fulvestrant (ISO) furan (EXP) gentamycin (EXP) glycidol (EXP) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) microcystin-LR (ISO) monosodium L-glutamate (ISO) paracetamol (EXP) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenytoin (ISO) pregnenolone 16alpha-carbonitrile (EXP) PRIM-O-GLUCOSYLCIMIFUGIN (EXP) propanal (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (EXP,ISO) sulfadimethoxine (EXP) T-2 toxin (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) Tungsten carbide (ISO) urethane (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Female-specific hypertension loci on rat chromosome 13.
Hoffman MJ, etal., Hypertension. 2013 Sep;62(3):557-63. doi: 10.1161/HYPERTENSIONAHA.113.01708. Epub 2013 Jul 1.
4.
Functional and molecular alterations of the glomerular barrier in long-term diabetes in mice.
Jeansson M, etal., Diabetologia. 2006 Sep;49(9):2200-9. Epub 2006 Jul 26.
5.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.
Sustained expression of proteoglycans and collagen type III/type I ratio in a calcified tendinopathy model.
Lui PP, etal., Rheumatology (Oxford). 2009 Dec 2.
7.
Immunohistochemical localization of fibromodulin in the periodontium during cementogenesis and root formation in the rat molar.
Matias MA, etal., J Periodontal Res. 2003 Oct;38(5):502-7.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
Immunohistochemical localization and expression of fibromodulin in adult rat periodontium and inflamed human gingiva.
Qian H, etal., Oral Dis. 2004 Jul;10(4):233-9.
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
14.
Small proteoglycans in human diabetic nephropathy: discrepancy between glomerular expression and protein accumulation of decorin, biglycan, lumican, and fibromodulin.
Schaefer L, etal., FASEB J. 2001 Mar;15(3):559-61. Epub 2001 Jan 19.
15.
Differential expression of fibromodulin, a transforming growth factor-beta modulator, in fetal skin development and scarless repair.
Soo C, etal., Am J Pathol. 2000 Aug;157(2):423-33.
Fmod Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 48,045,567 - 48,056,184 (+) NCBI GRCr8 mRatBN7.2 13 45,493,517 - 45,504,134 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 45,493,517 - 45,504,133 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 48,101,962 - 48,112,556 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 49,390,009 - 49,400,605 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 46,654,575 - 46,665,165 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 50,874,886 - 50,885,503 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 50,873,605 - 50,885,563 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 55,927,583 - 55,939,041 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 46,987,714 - 46,998,331 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 47,001,756 - 47,012,373 (+) NCBI Celera 13 45,822,144 - 45,832,470 (+) NCBI Celera RH 3.4 Map 13 184.4 RGD Cytogenetic Map 13 q13 NCBI
FMOD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 203,340,628 - 203,351,122 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 203,340,628 - 203,351,758 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 203,309,756 - 203,320,250 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 201,576,375 - 201,586,912 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 200,041,413 - 200,049,060 NCBI Celera 1 176,439,022 - 176,449,562 (-) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 174,474,902 - 174,485,714 (-) NCBI HuRef CHM1_1 1 204,732,638 - 204,743,449 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 202,603,493 - 202,613,991 (-) NCBI T2T-CHM13v2.0
Fmod Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 133,964,992 - 133,976,018 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 133,964,992 - 133,976,015 (+) Ensembl GRCm39 Ensembl GRCm38 1 134,037,254 - 134,048,280 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 134,037,254 - 134,048,277 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 135,934,092 - 135,944,854 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 135,853,926 - 135,864,688 (+) NCBI MGSCv36 mm8 Celera 1 136,653,909 - 136,670,078 (+) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 58.09 NCBI
Fmod Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 39,328,743 - 39,340,258 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 39,328,743 - 39,340,113 (-) NCBI ChiLan1.0 ChiLan1.0
FMOD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 46,026,552 - 46,037,305 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 45,993,588 - 46,004,297 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 178,942,472 - 178,953,158 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 183,236,412 - 183,247,057 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 183,238,130 - 183,244,074 (-) Ensembl panpan1.1 panPan2
FMOD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 102,106 - 112,267 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 103,230 - 112,154 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 192,095 - 202,277 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 98,889 - 109,072 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 98,893 - 108,988 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 91,412 - 101,593 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 485,490 - 495,671 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 699,365 - 709,547 (-) NCBI UU_Cfam_GSD_1.0
Fmod Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 72,036,724 - 72,047,975 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936567 1,271,252 - 1,282,841 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936567 1,271,401 - 1,282,651 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FMOD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 64,063,001 - 64,073,858 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 64,062,995 - 64,073,853 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 70,356,603 - 70,367,308 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FMOD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 25,992,006 - 26,002,909 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 25,992,228 - 26,003,109 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 26,768,097 - 26,779,048 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fmod
.
Predicted Target Of
Count of predictions: 179 Count of miRNA genes: 128 Interacting mature miRNAs: 153 Transcripts: ENSRNOT00000004382 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 12879436 Bp395 Blood pressure QTL 395 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 44639182 45700190 Rat 6893344 Cm79 Cardiac mass QTL 79 1.5 0.04 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 43720770 62022792 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879444 Bp397 Blood pressure QTL 397 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45049404 45516593 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 4145117 Mcs27 Mammary carcinoma susceptibility QTL 27 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 13 43437904 47841255 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 12879472 Bp399 Blood pressure QTL 399 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45228358 47841255 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
D13Rat125
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 48,049,871 - 48,050,118 (+) Marker Load Pipeline mRatBN7.2 13 45,497,821 - 45,498,068 (+) MAPPER mRatBN7.2 Rnor_6.0 13 50,879,191 - 50,879,437 NCBI Rnor6.0 Rnor_5.0 13 55,932,728 - 55,932,974 UniSTS Rnor5.0 RGSC_v3.4 13 46,992,018 - 46,992,265 RGD RGSC3.4 RGSC_v3.4 13 46,992,019 - 46,992,265 UniSTS RGSC3.4 RGSC_v3.1 13 47,005,943 - 47,006,315 RGD SHRSP x BN Map 13 14.8199 UniSTS SHRSP x BN Map 13 14.8199 RGD Cytogenetic Map 13 q13 UniSTS
RH133402
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 45,503,765 - 45,503,953 (+) MAPPER mRatBN7.2 Rnor_6.0 13 50,885,135 - 50,885,322 NCBI Rnor6.0 Rnor_5.0 13 55,938,672 - 55,938,859 UniSTS Rnor5.0 RGSC_v3.4 13 46,997,963 - 46,998,150 UniSTS RGSC3.4 Celera 13 45,832,102 - 45,832,289 UniSTS RH 3.4 Map 13 171.9 UniSTS Cytogenetic Map 13 q13 UniSTS
RH142446
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 45,503,702 - 45,503,880 (+) MAPPER mRatBN7.2 Rnor_6.0 13 50,885,072 - 50,885,249 NCBI Rnor6.0 Rnor_5.0 13 55,938,609 - 55,938,786 UniSTS Rnor5.0 RGSC_v3.4 13 46,997,900 - 46,998,077 UniSTS RGSC3.4 Celera 13 45,832,039 - 45,832,216 UniSTS RH 3.4 Map 13 184.4 UniSTS Cytogenetic Map 13 q13 UniSTS
PMC133870P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 45,496,238 - 45,496,655 (+) MAPPER mRatBN7.2 Rnor_6.0 13 50,877,608 - 50,878,024 NCBI Rnor6.0 Rnor_5.0 13 55,931,145 - 55,931,561 UniSTS Rnor5.0 RGSC_v3.4 13 46,990,436 - 46,990,852 UniSTS RGSC3.4 Celera 13 45,824,866 - 45,825,282 UniSTS Cytogenetic Map 13 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004382 ⟹ ENSRNOP00000004382
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 45,493,517 - 45,504,133 (+) Ensembl Rnor_6.0 Ensembl 13 50,873,605 - 50,885,563 (+) Ensembl
RefSeq Acc Id:
NM_080698 ⟹ NP_542429
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 48,045,567 - 48,056,184 (+) NCBI mRatBN7.2 13 45,493,517 - 45,504,134 (+) NCBI Rnor_6.0 13 50,874,886 - 50,885,503 (+) NCBI Rnor_5.0 13 55,927,583 - 55,939,041 (+) NCBI RGSC_v3.4 13 46,987,714 - 46,998,331 (+) RGD Celera 13 45,822,144 - 45,832,470 (+) RGD
Sequence:
GAGGCCAAACAGAAGGACGTGGTCACTCTGAACGGTTCAACCCAAGGGACAACATGCAGTGGGCCTCCATCCTGCTGCTGCGCGGGCTCTGCTCGCTTTCCCAGGGCCAGTATGAAGAAGACTCTCAC
hide sequence
RefSeq Acc Id:
NP_542429 ⟸ NM_080698
- Peptide Label:
precursor
- UniProtKB:
P50609 (UniProtKB/Swiss-Prot), A6ICA0 (UniProtKB/TrEMBL), G3V6E7 (UniProtKB/TrEMBL)
- Sequence:
MQWASILLLRGLCSLSQGQYEEDSHWWLQYLRNQQSTYYDPYDTYPYETSDPYPYEVEEGPAYAYGAPPPPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQIAAIQEGVFDNA
hide sequence
Ensembl Acc Id:
ENSRNOP00000004382 ⟸ ENSRNOT00000004382
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Fmod
fibromodulin
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Fmod
fibromodulin
Symbol and Name status set to provisional
70820 PROVISIONAL
