Advanced Search (OLGA)

Gene: Pou3f1 (POU class 3 homeobox 1) Rattus norvegicus

Analyze

Symbol:

Pou3f1

Name:

POU class 3 homeobox 1

RGD ID:

619767

Description:

Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in glial cell differentiation and negative regulation of transcription by RNA polymerase II. Acts upstream of or within positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of transcription regulator complex. Orthologous to human POU3F1 (POU class 3 homeobox 1); INTERACTS WITH 2,3,4,7,8-Pentachlorodibenzofuran; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Oct-6; octamer-binding protein 6; octamer-binding transcription factor 6; octoamer transcription factor-6; octomer-6; OTF-6; Otf6; POU domain transcription factor SCIP; POU domain, class 3, transcription factor 1; Scip; suppressed cAMP-inducible POU; Testes-1; Tst-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU3F1 (POU class 3 homeobox 1)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Pou3f1 (POU domain, class 3, transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU3F1 (POU class 3 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU3F1 (POU class 3 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU3F1 (POU class 3 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POU3F1 (POU class 3 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou3f1 (POU class 3 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	POU3F1 (POU class 3 homeobox 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pou3f1 (POU domain, class 3, transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou3f1 (POU class 3 homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-6	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vvl	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pou3f1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,195,090 - 142,198,070 (+)	NCBI		GRCr8
mRatBN7.2	5	136,910,391 - 136,913,371 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,910,391 - 136,913,371 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	139,613,780 - 139,616,760 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,383,791 - 141,386,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,390,973 - 141,393,953 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,643,599 - 142,646,580 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,643,599 - 142,646,580 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	146,414,652 - 146,417,633 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	143,981,547 - 143,984,527 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	143,991,539 - 143,994,520 (+)	NCBI
Celera	5	135,433,883 - 135,436,881 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

rheumatoid arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

actinomycin D (ISO)

all-trans-retinoic acid (EXP,ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

aristolochic acids (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbamazepine (ISO)

choline (ISO)

cisplatin (ISO)

cocaine (EXP)

Cuprizon (EXP)

diazinon (ISO)

dimethylarsinic acid (EXP)

diuron (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

genistein (ISO)

iron dichloride (ISO)

L-methionine (ISO)

lead(0) (ISO)

Licochalcone B (ISO)

mercury dibromide (ISO)

methimazole (EXP)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

niclosamide (ISO)

Nutlin-3 (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

epidermis development (ISO)

forebrain development (IEA,ISO)

glial cell differentiation (IDA)

keratinocyte differentiation (IEA,ISO)

myelination (ISO)

myelination in peripheral nervous system (IEA,ISO)

negative regulation of DNA-templated transcription (IDA)

negative regulation of transcription by RNA polymerase II (IDA)

positive regulation of DNA-templated transcription (IEA,ISO,ISS)

positive regulation of gene expression (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IDA,IGI)

regulation of DNA-templated transcription (IDA,TAS)

regulation of transcription by RNA polymerase II (IBA,IEA)

Schwann cell development (ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (ISO,ISS)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription factor activity (IDA,TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IDA,IEA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IDA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA)

sequence-specific DNA binding (IDA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of genes that are downregulated in the absence of the POU domain transcription factor pou3f1 (Oct-6, Tst-1, SCIP) in sciatic nerve.	Bermingham JR Jr, etal., J Neurosci 2002 Dec 1;22(23):10217-31.
2.	Sp1- and octamer-consensus sequence binding proteins during lens fibre differentiation.	Brunekreef GA, etal., Exp Eye Res. 1997 Mar;64(3):295-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Tst-1, a member of the POU domain gene family, binds the promoter of the gene encoding the cell surface adhesion molecule P0.	He X, etal., Mol Cell Biol 1991 Mar;11(3):1739-44.
6.	The POU factor Oct-6 and Schwann cell differentiation.	Jaegle M, etal., Science 1996 Jul 26;273(5274):507-10.
7.	Cooperative function of POU proteins and SOX proteins in glial cells.	Kuhlbrodt K, etal., J Biol Chem 1998 Jun 26;273(26):16050-7.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Expression and activity of the POU transcription factor SCIP.	Monuki ES, etal., Science 1990 Sep 14;249(4974):1300-3.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:2739723	PMID:9105675	PMID:9242494	PMID:12782656	PMID:15282162	PMID:15713637	PMID:18505825	PMID:19527706	PMID:21653862	PMID:22992956

Genomics

Comparative Map Data

Pou3f1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,195,090 - 142,198,070 (+)	NCBI		GRCr8
mRatBN7.2	5	136,910,391 - 136,913,371 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,910,391 - 136,913,371 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	139,613,780 - 139,616,760 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,383,791 - 141,386,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,390,973 - 141,393,953 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,643,599 - 142,646,580 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,643,599 - 142,646,580 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	146,414,652 - 146,417,633 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	143,981,547 - 143,984,527 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	143,991,539 - 143,994,520 (+)	NCBI
Celera	5	135,433,883 - 135,436,881 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

POU3F1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	38,043,829 - 38,046,793 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	38,043,829 - 38,046,793 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	38,509,501 - 38,512,465 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	38,282,110 - 38,285,037 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	38,179,370 - 38,181,518	NCBI
Celera	1	36,788,160 - 36,791,086 (-)	NCBI		Celera
Cytogenetic Map	1	p34.3	NCBI
HuRef	1	36,628,084 - 36,630,296 (-)	NCBI		HuRef
CHM1_1	1	38,625,220 - 38,628,147 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	37,911,007 - 37,913,971 (-)	NCBI		T2T-CHM13v2.0

Pou3f1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	124,551,439 - 124,554,448 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	124,550,600 - 124,554,448 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	124,657,646 - 124,660,655 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	124,656,807 - 124,660,655 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	124,334,889 - 124,337,899 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	124,159,956 - 124,161,473 (+)	NCBI		MGSCv36	mm8
Celera	4	122,983,916 - 122,986,325 (+)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	57.86	NCBI

POU3F1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	188,792,247 - 188,795,216 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	187,921,407 - 187,924,375 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	37,317,800 - 37,320,004 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

POU3F1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	4,547,868 - 4,549,469 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	4,547,920 - 4,549,469 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	4,790,366 - 4,793,455 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	4,675,978 - 4,679,074 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	4,675,978 - 4,677,348 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	4,536,678 - 4,539,775 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	4,603,051 - 4,604,421 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	4,619,497 - 4,622,595 (+)	NCBI		UU_Cfam_GSD_1.0

POU3F1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	94,026,675 - 94,028,030 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	94,025,133 - 94,028,053 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	86,796,219 - 86,798,759 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU3F1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	94,823,724 - 94,826,715 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	94,823,783 - 94,825,141 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	22,000,081 - 22,002,282 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou3f1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	20,684,402 - 20,685,757 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	20,682,883 - 20,685,774 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou3f1
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	137
Count of miRNA genes:	118
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000074492
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
7411722	Strs6	Sensitivity to stroke QTL 6	3.9		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	5	134972980	138113556	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

UniSTS:484976

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,910,380 - 136,911,868 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,643,589 - 142,645,077	NCBI	Rnor6.0
Rnor_5.0	5	146,414,642 - 146,416,130	UniSTS	Rnor5.0
RGSC_v3.4	5	143,981,537 - 143,983,024	UniSTS	RGSC3.4
Celera	5	135,433,873 - 135,435,378	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:485716

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,910,345 - 136,911,864 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,643,554 - 142,645,073	NCBI	Rnor6.0
Rnor_5.0	5	146,414,607 - 146,416,126	UniSTS	Rnor5.0
RGSC_v3.4	5	143,981,502 - 143,983,020	UniSTS	RGSC3.4
Celera	5	135,433,838 - 135,435,374	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:495494

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,910,344 - 136,911,861 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,643,553 - 142,645,070	NCBI	Rnor6.0
Rnor_5.0	5	146,414,606 - 146,416,123	UniSTS	Rnor5.0
RGSC_v3.4	5	143,981,501 - 143,983,017	UniSTS	RGSC3.4
Celera	5	135,433,837 - 135,435,371	UniSTS
Cytogenetic Map	5	q36	UniSTS

Pou3f1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,911,338 - 136,911,429 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,644,548 - 142,644,638	NCBI	Rnor6.0
Rnor_5.0	5	146,415,601 - 146,415,691	UniSTS	Rnor5.0
RGSC_v3.4	5	143,982,495 - 143,982,585	UniSTS	RGSC3.4
Celera	5	135,434,831 - 135,434,921	UniSTS
Cytogenetic Map	5	q36	UniSTS

Pou3f1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,911,196 - 136,911,596 (+)	MAPPER	mRatBN7.2
mRatBN7.2	9	44,946,898 - 44,947,298 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,644,406 - 142,644,805	NCBI	Rnor6.0
Rnor_6.0	9	49,480,160 - 49,480,559	NCBI	Rnor6.0
Rnor_5.0	5	146,415,459 - 146,415,858	UniSTS	Rnor5.0
Rnor_5.0	9	49,152,546 - 49,152,945	UniSTS	Rnor5.0
Celera	5	135,434,689 - 135,435,106	UniSTS
Celera	9	42,666,018 - 42,666,417	UniSTS
Cytogenetic Map	5	q36	UniSTS
Cytogenetic Map	9	q22	UniSTS

Pou3f1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,910,376 - 136,910,599 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,643,585 - 142,643,807	NCBI	Rnor6.0
Rnor_5.0	5	146,414,638 - 146,414,860	UniSTS	Rnor5.0
Celera	5	135,433,869 - 135,434,091	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	11	31	108	62	57	39	18	39	6	164	67	93	45	57	18

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M63712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M72711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M74095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074492

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	136,910,391 - 136,913,371 (+)	Ensembl
Rnor_6.0 Ensembl	5	142,643,599 - 142,646,580 (+)	Ensembl

RefSeq Acc Id:

NM_138838 ⟹ NP_620193

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	142,195,090 - 142,198,070 (+)	NCBI
mRatBN7.2	5	136,910,391 - 136,913,371 (+)	NCBI
Rnor_6.0	5	142,643,599 - 142,646,580 (+)	NCBI
Rnor_5.0	5	146,414,652 - 146,417,633 (+)	NCBI
RGSC_v3.4	5	143,981,547 - 143,984,527 (+)	RGD
Celera	5	135,433,883 - 135,436,881 (+)	RGD

Sequence:

show sequence

GGCGGCGGCGGCGGCGCGGCGCAGGGCGCGGGGCGGCATGGCCACCACCGCGCAGTATCTGCCG
CGGGGCCCCGGCGGCGGAGCTGGGGGCACCGGGCCGCTCATGCATCCCGATGCCGCCGCGGCGG
CGGCAGCGGCGGCGGCGGCCGAGCGGCTGCACGCGGGGGCCGCGTACCGCGAAGTGCAGAAGCT
GATGCACCACGAGTGGCTGGGCGCGGGCGCGGGCCACCCCGTGGGCCTAGCGCACCCTCAATGG
CTACCCACGGGAGGAGGCGGCGGCGGCGACTGGGCGGGCGGCCCGCACCTGGAACACGGCAAGG
CAGGCGGTGGCAGTACCGGCCGAGCTGACGACGGCGGCGGTGGCGGAGGTTTCCACGCCCGCTT
GGTGCACCAAGGGGCGGCCCACGCGGGCGCGGCATGGGCACAAGGCGGCACAGCGCACCACTTG
GGCCCCGCCATGTCGCCGTCGCCCGGGGCCGGCGGGGGTCACCAGCCCCAGCCGCTCGGGCTGT
ACGCTCAGGCGGCCTACCCCGGTGGCGGCGGCGGCGGCCTGGCCGGGATGTTGGCGGCGGGAGG
CGGCGGCGCGGGACCCGGCCTGCACCACGCGCTGCACGAGGACGGCCACGAGGCACAGCTGGAG
CCGTCGCCACCACCGCACCTGGGCGCACACGGACACGCACACGGACATGCACACGCGGGCGGCC
TGCACGCGGCGGCGGCGCACCTGCACCCAGGCGCGGGCGGTGGTGGCTCGTCGGTGGGCGAGCA
CTCGGACGAGGATGCTCCCAGCTCCGACGACCTGGAGCAGTTCGCCAAGCAGTTCAAGCAACGA
CGCATCAAGCTGGGCTTCACCCAGGCCGACGTGGGGCTAGCGCTGGGCACCCTCTACGGTAATG
TGTTCTCGCAGACCACCATCTGCCGCTTCGAGGCCCTGCAGCTGAGCTTCAAGAACATGTGCAA
GCTCAAACCGCTGCTCAACAAGTGGCTGGAGGAGACCGACTCGTCCAGCGGCAGCCCCACCAAC
CTGGACAAGATCGCGGCGCAGGGCCGCAAGCGCAAGAAGCGCACGTCCATTGAGGTGGGTGTCA
AAGGCGCGCTCGAGAGCCACTTTCTCAAGTGTCCCAAGCCGTCTGCGCACGAGATCACCGGCCT
GGCCGACAGCCTGCAACTGGAGAAGGAGGTGGTGCGTGTCTGGTTCTGCAACCGGCGGCAGAAG
GAGAAGCGCATGACCCCCGCGGCCGGCGCGGGCCACCCGCCCATGGACGACGTTTATGCGCCTG
GGGAGCTGGGGCCTGGCGGAGGCGGCGCGTCGCCACCCTCTGCGCCCCCGCCACCCCCGCCGGC
CGCGCTACACCACCACCATCACCACACACTACCCGGCTCCGTGCAGTGACCCTGCGGACTGGGT
TCCCCGCCGGCGCAGCGGTGCCTCCGGCGCGCAGCCAGCGCGCGCGGCCTGGACTCTTTTTGTT
GTTTATTCGGTTGCTTTGGATTTTACAAAAAGAAAAAAGGAAAAAAAAAAAAGCCCAGAAACTT
TTAAACAAAACCAAACACCCGGGACCGACCCCTCTCTCTGGCGAGCGGCGAAAGGCGGCCGAGA
GGCTGTGTTGCCCGAGCCCAGGGAGAGAGCAGCGAAGATCCAGAATGCGCCAACTCACTCTGGG
CGCCCTGCGCCCACTGCCTGCTCCCTATCCCCATCCCCTCGACGACCCCCGCCCCTGCCCCCGG
GCTGTTCGGGGCCGGATCCCGGCAGCGGCCTCCCCACAGCGAAAGGTAACGCGGTGCGGGATTA
GGGATTCCCCGGGAGAATGGACGAAAAGAGGAGAGTCCCCAGCAGCTCTCCCGGGCGCGGACTC
CCTGTAGCCTGCAGGTCACGGGTGGGGGGCTGTCACTTTATTCTTTCCGCGCCTCTTCTCGCAC
CTGGACGCGCCCCACCCCCTCACCTTTTCTCCGGGCTTGGTTTTTTACGGTTTTTATTTATTCG
TGGAGCCTCTCGGCTCCTGGGGTCCTTCTAACTCCGCCCGCGCCCTTAATTTAAATCGCTGTAT
ACTGTATTTATCGGGGCCCCAGAGGGGAGGCCGCGAGAGCCGCATCTGTGTATAAAAGCAGGAA
ATAGCCAAAGCTTTAATCTAGCCTAATTTATTTTCCCTTTCTCTTCCCCTCTCCTCCTTCAAGA
ACGCAAAACAAAAACAAAAAAAAACTAACAAAAAAAAATTTTTTGAGTGTTCATTTTTCGTTTC
GTTTTACCAGAGCCCTCGGCTCGGTTCCTGGCCTAGCAGAGAGGGTCTGCGCTCCCACGCACAC
CCGGGTGGGAAGGGGCATCTTCACCCGCAAGATCGAGCGCGCACCGGGCCACTGCTTCCCCGCC
GGCCCTGCCCTCCTGGCCTTAACGAACGAAACTTGGAAAAGTTGGAACTATTTTTTAACTAGCT
GTAGAAATAAACCGTTCCCCCAAGAACCTTCCGCCTGTTTCCCTACCGCTTCCCCCTGCTCTCT
TTCCAGCCCCCGCGGGATGCAAGGATGCTGGGGGAACCCTGGGGAGAAACTCTCCAAATTTGGG
GTGAGGTGGGAACCATGTAAATATGTGAGATATGTACACAATGGCGGGGGGGAAGAAACACTTT
GTGCTTGGTTTTTATTTTTTGGCTTTCTGGGTTGTTCTCCCTCCCCACCCTAAAGGGTTTTGTA
TGCCCGACTAAACCGAAAAAGATATTTTAATATGGTTTCCTAATTTCTGACCCATCTCTATTTA
TTTTCTGGATGTGTTTGGAGCTTCCCCCCTTCACCATTTCTTCATCTGTTTCTTAAGGTTTGAG
CGTAATTTTTTTTTAAATTTTTTGTTATTCTCAGAAAAATGTTTTGGTCCATTCTCTTTGTATC
TTTATTGCAAAAAATAATAATAATGTAGACTGGGAAGTTCCCTTTATATTTATGTTATAGTAAA
TATTTTATTACTCACATAAACATGTACCCCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_620193	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42118	(Get FASTA)	NCBI Sequence Viewer
	AAA42303	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091966.1
GenBank Protein	P20267	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620193 ⟸ NM_138838

- UniProtKB:

P20267 (UniProtKB/Swiss-Prot), A0A8I6GJZ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGH
PVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGSTGRADDGGGGGGFHARLVHQGAAHAGAAW
AQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALH
EDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLE
QFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEET
DSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVR
VWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGGASPPSAPPPPPPAALHHHHHHTLPG
SVQ

hide sequence

Protein Domains

Homeobox POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20267-F1-model_v2	AlphaFold	P20267	1-451	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619767	AgrOrtholog
BioCyc Gene	G2FUF-39960	BioCyc
Ensembl Genes	ENSRNOG00000047686	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000074492.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_domain_TF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:192110	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	192110	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU DOMAIN, CLASS 3, TRANSCRIPTION FACTOR 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pou	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pou3f1	PhenoGen
PIRSF	Transcription_factor_POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000047686	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47413	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GJZ5	ENTREZGENE, UniProtKB/TrEMBL
	P20267	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Pou3f1	POU class 3 homeobox 1	Pou3f1	POU domain, class 3, transcription factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Pou3f1	POU domain, class 3, transcription factor 1			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Pou3f1	POU domain, class 3, transcription factor 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed during Schwann cell development	628407
gene_process	required for normal differentiation of myelinating Schwann cells	628407
gene_process	regulates the expression of fatty acid transport protein P2,cystein-rich protein-1 (Crp-1) and Crp2, tramdorin1 and dendrin in Schwann cells	628407
gene_product	member of POU domain transcription factor family	628407

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD