Advanced Search (OLGA)

Gene: Pxmp2 (peroxisomal membrane protein 2) Rattus norvegicus

Analyze

Symbol:

Pxmp2

Name:

peroxisomal membrane protein 2

RGD ID:

61812

Description:

Located in peroxisomal membrane. Orthologous to human PXMP2 (peroxisomal membrane protein 2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

22 kDa peroxisomal membrane protein; liver regeneration-related protein LRRG01; peroxisomal membrane protein 2 22 kDa; peroxisomal membrane protein 2, 22 kDa; PMP 22; T44

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PXMP2 (peroxisomal membrane protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, Treefam
Mus musculus (house mouse):	Pxmp2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pxmp2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PXMP2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PXMP2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pxmp2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PXMP2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PXMP2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pxmp2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pxmp2 (peroxisomal membrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC15A4 (solute carrier family 15 member 4)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pxmp2 (peroxisomal membrane protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PXMP2 (peroxisomal membrane protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pxmp2 (peroxisomal membrane protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SYM1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG7970	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG7970	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	YOR292C	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pxmp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pxmp2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	52,053,951 - 52,064,283 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	52,053,788 - 52,064,283 (+)	Ensembl				GRCr8
mRatBN7.2	12	46,394,051 - 46,404,561 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,394,193 - 46,404,557 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	47,569,991 - 47,580,278 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	48,175,416 - 48,185,705 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	47,235,941 - 47,246,231 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,452,354 - 52,462,655 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,452,273 - 52,462,659 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	54,187,729 - 54,198,030 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	46,540,320 - 46,550,621 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	47,950,611 - 47,960,912 (+)	NCBI		Celera
RGSC_v3.1	12	46,407,254 - 46,417,553 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aconitine (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

disodium selenite (ISO)

epoxiconazole (ISO)

ethanol (EXP)

fenthion (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

glucose (ISO)

hydrogen peroxide (ISO)

indometacin (EXP)

isotretinoin (ISO)

L-methionine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

methoxyacetic acid (ISO)

methylmercury chloride (ISO)

Monobutylphthalate (ISO)

monosodium L-glutamate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nitrofen (EXP)

okadaic acid (ISO)

ozone (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pioglitazone (ISO)

pirinixic acid (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sulforaphane (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IBA,ISO)

membrane (IEA)

peroxisomal membrane (IBA,IDA,IEA,ISO)

peroxisome (IDA)

protein-containing complex (ISO)

Molecular Function

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Two different targeting signals direct human peroxisomal membrane protein 22 to peroxisomes.	Brosius U, etal., J Biol Chem. 2002 Jan 4;277(1):774-84. Epub 2001 Oct 5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Membrane topology of the 22 kDa integral peroxisomal membrane protein.	Kaldi K, etal., FEBS Lett 1993 Jan 11;315(3):217-22.
4.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Identification of a 24 kDa intrinsic membrane protein from mammalian peroxisomes.	Reguenga C, etal., Biochim Biophys Acta. 1999 Jun 9;1445(3):337-41.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8624723	PMID:18174172	PMID:18614015	PMID:18984054	PMID:19352492	PMID:19946888

Genomics

Comparative Map Data

Pxmp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	52,053,951 - 52,064,283 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	52,053,788 - 52,064,283 (+)	Ensembl				GRCr8
mRatBN7.2	12	46,394,051 - 46,404,561 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,394,193 - 46,404,557 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	47,569,991 - 47,580,278 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	48,175,416 - 48,185,705 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	47,235,941 - 47,246,231 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,452,354 - 52,462,655 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,452,273 - 52,462,659 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	54,187,729 - 54,198,030 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	46,540,320 - 46,550,621 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	47,950,611 - 47,960,912 (+)	NCBI		Celera
RGSC_v3.1	12	46,407,254 - 46,417,553 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

PXMP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	132,687,587 - 132,704,985 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	132,687,587 - 132,705,098 (+)	Ensembl			hg38	GRCh38
GRCh37	12	133,264,173 - 133,281,571 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	131,774,265 - 131,791,650 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	131,874,541 - 131,891,926	NCBI
Celera	12	132,966,844 - 132,981,555 (+)	NCBI		Celera
Cytogenetic Map	12	q24.33	NCBI
HuRef	12	130,043,189 - 130,060,720 (+)	NCBI		HuRef
CHM1_1	12	133,084,186 - 133,101,567 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	132,737,814 - 132,753,863 (+)	NCBI		T2T-CHM13v2.0

Pxmp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	110,422,152 - 110,434,036 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	110,422,148 - 110,434,052 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	110,274,286 - 110,286,222 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	110,274,282 - 110,286,186 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	110,703,305 - 110,715,187 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	110,514,862 - 110,526,307 (-)	NCBI		MGSCv36	mm8
Celera	5	107,398,021 - 107,409,799 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	53.44	NCBI

Pxmp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	366,874 - 373,125 (-)	Ensembl
ChiLan1.0	NW_004955482	366,613 - 373,339 (-)	NCBI	ChiLan1.0	ChiLan1.0

PXMP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	140,796,709 - 140,811,702 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	140,793,264 - 140,808,219 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	130,038,499 - 130,054,415 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	134,758,728 - 134,782,122 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	134,758,728 - 134,782,122 (+)	Ensembl			panPan2	panpan1.1

PXMP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	417,779 - 427,724 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	418,056 - 427,823 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	459,714 - 469,802 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	475,398 - 485,488 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	464,505 - 485,472 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	416,730 - 426,871 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	503,795 - 513,875 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	435,012 - 445,089 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pxmp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	122,076,677 - 122,098,041 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936660	2,622,992 - 2,632,586 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936660	2,623,027 - 2,643,976 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PXMP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	22,780,161 - 22,797,962 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	22,784,212 - 22,798,019 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PXMP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	128,030,507 - 128,044,231 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	128,030,525 - 128,045,503 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	116,821,916 - 116,836,251 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pxmp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624747	28,068,343 - 28,076,183 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pxmp2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	44,072,570 - 44,082,958 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	103
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000056680
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

RH132122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	46,404,362 - 46,404,556 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	52,462,465 - 52,462,658	NCBI	Rnor6.0
Rnor_5.0	12	54,197,840 - 54,198,033	UniSTS	Rnor5.0
RGSC_v3.4	12	46,550,431 - 46,550,624	UniSTS	RGSC3.4
Celera	12	47,960,722 - 47,960,915	UniSTS
RH 3.4 Map	12	796.4	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	165	91	90	59	86	59	6	349	185	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120688	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY176054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY327502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X70223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056680 ⟹ ENSRNOP00000053518

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	52,053,966 - 52,064,281 (+)	Ensembl
mRatBN7.2 Ensembl	12	46,394,193 - 46,404,557 (+)	Ensembl
Rnor_6.0 Ensembl	12	52,452,273 - 52,462,659 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088381 ⟹ ENSRNOP00000075490

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	52,053,966 - 52,064,279 (+)	Ensembl
mRatBN7.2 Ensembl	12	46,394,243 - 46,404,557 (+)	Ensembl
Rnor_6.0 Ensembl	12	52,452,331 - 52,462,659 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093969 ⟹ ENSRNOP00000083828

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	52,053,788 - 52,064,283 (+)	Ensembl
mRatBN7.2 Ensembl	12	46,394,193 - 46,399,740 (+)	Ensembl

RefSeq Acc Id:

NM_031587 ⟹ NP_113775

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	52,053,951 - 52,064,283 (+)	NCBI
mRatBN7.2	12	46,394,228 - 46,404,561 (+)	NCBI
Rnor_6.0	12	52,452,354 - 52,462,655 (+)	NCBI
Rnor_5.0	12	54,187,729 - 54,198,030 (+)	NCBI
RGSC_v3.4	12	46,540,320 - 46,550,621 (+)	RGD
Celera	12	47,950,611 - 47,960,912 (+)	RGD

Sequence:

show sequence

AATTCGGCACGAGCGCGATGGCACCTGCCGCGTCAAGGCTGAGGGTGGAATCCGAGCTCCGGTC
GCTTCCCAAGCGAGCGCTCGCCCAATACTTGCTGTTTCTAAAGTTCTATCCGGTGGTCACCAAA
GCTGTCAGCAGTGGCATTTTGTCAGCCCTTGGAAACCTTCTGGCCCAGATGATTGAGAAGAAGC
AGAAAAAAGACTCTCGAAGTCTAGAAGTCAGTGGGCTTCTCAGATATTTAGTTTATGGGTTGTT
TGTCACAGGTCCCCTGAGTCACTACCTCTACCTCTTCATGGAGTACTGGGTCCCTCCTGAGGTT
CCCTGGGCCAGAGTCAAGAGGCTCCTGCTGGATCGCCTGTTCTTTGCCCCAACCTTTCTGCTGC
TGTTCTTCTTCGTCATGAACTTGCTGGAGGGAAAAAACATCAGTGTCTTTGTTGCCAAGATGAG
GAGTGGCTTCTGGCCTGCTCTGCAAATGAACTGGAGGATGTGGACACCCTTACAGTTCATCAAC
ATCAACTATGTGCCCTTGCAGTTCCGGGTGCTCTTTGCCAACATGGCAGCTCTGTTCTGGTATG
CCTACCTGGCCTCTCTGGGGAAGTGATGTCTGATACACCGTGGATGAGGTGTGGGGAGATCCAA
CCACCAGCAGGAGAGAGCAGAATCCATCATTAAGGACACCTCATGACTAAATTATGTGATTCAA
GATGCCTTAAAATTACAGAGGGAGGAACGTGTCAGTGTCGGAATCATGTGCTTCAAAGAGACAG
CACTAGTCTCGGTGGAGTTAATCTTAGTTGTCACTGCAAACAGGTAAAGGTCAATAAACAGTGA
TGCAGCCTCGTGCCGAATTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113775	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAO46106	(Get FASTA)	NCBI Sequence Viewer
	AAP97734	(Get FASTA)	NCBI Sequence Viewer
	CAA49756	(Get FASTA)	NCBI Sequence Viewer
	EDM14055	(Get FASTA)	NCBI Sequence Viewer
	EDM14056	(Get FASTA)	NCBI Sequence Viewer
	EDM14057	(Get FASTA)	NCBI Sequence Viewer
	EDM14058	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053518
GenBank Protein	Q07066	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113775 ⟸ NM_031587
- UniProtKB:	Q07066 (UniProtKB/Swiss-Prot), G3V9N2 (UniProtKB/TrEMBL), A6J2B7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPAASRLRVESELRSLPKRALAQYLLFLKFYPVVTKAVSSGILSALGNLLAQMIEKKQKKDSR SLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYWVPPEVPWARVKRLLLDRLFFAPTFLLLFFFVM NLLEGKNISVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMAALFWYAYLASL GK hide sequence

Ensembl Acc Id:

ENSRNOP00000053518 ⟸ ENSRNOT00000056680

Ensembl Acc Id:

ENSRNOP00000075490 ⟸ ENSRNOT00000088381

Ensembl Acc Id:

ENSRNOP00000083828 ⟸ ENSRNOT00000093969

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q07066-F1-model_v2	AlphaFold	Q07066	1-194	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698754

Promoter ID:

EPDNEW_R9263

Type:

initiation region

Name:

Pxmp2_1

Description:

peroxisomal membrane protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	52,452,346 - 52,452,406	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61812	AgrOrtholog
BioCyc Gene	G2FUF-18803	BioCyc
Ensembl Genes	ENSRNOG00000037446	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000056680	ENTREZGENE
InterPro	Mpv17_PMP22	UniProtKB/Swiss-Prot
KEGG Report	rno:29533	UniProtKB/Swiss-Prot
NCBI Gene	29533	ENTREZGENE
PANTHER	PEROXISOMAL MEMBRANE PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR11266	UniProtKB/Swiss-Prot
Pfam	Mpv17_PMP22	UniProtKB/Swiss-Prot
PhenoGen	Pxmp2	PhenoGen
RatGTEx	ENSRNOG00000037446	RatGTEx
TIGR	TC229542
UniProt	A0A0G2KAQ8_RAT	UniProtKB/TrEMBL
	A0A8I5ZXT4_RAT	UniProtKB/TrEMBL
	A6J2B6_RAT	UniProtKB/TrEMBL
	A6J2B7	ENTREZGENE, UniProtKB/TrEMBL
	A6J2B8_RAT	UniProtKB/TrEMBL
	A6J2B9_RAT	UniProtKB/TrEMBL
	G3V9N2	ENTREZGENE, UniProtKB/TrEMBL
	PXMP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Pxmp2	peroxisomal membrane protein 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message