Advanced Search (OLGA)

Gene: Pgc (progastricsin) Rattus norvegicus

Analyze

Symbol:

Pgc

Name:

progastricsin

RGD ID:

3943

Description:

Predicted to enable aspartic-type endopeptidase activity. Predicted to be involved in positive regulation of antibacterial peptide production and proteolysis. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human PGC (progastricsin); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3,3',4,4',5-pentachlorobiphenyl; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gastricsin; pepsinogen C; Pg-1; PG1; progastricsin (pepsinogen C); Upg1; Urinary pepsinogen 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGC (progastricsin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pgc (progastricsin (pepsinogen C))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgc (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGC (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGC (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pgc (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGC (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGC (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgc (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pgc (progastricsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PGC (progastricsin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pgc (progastricsin (pepsinogen C))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Bace	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Bace	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	PEP4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asp-1	Alliance	DIOPT (Ensembl Compara\|OMA)
Drosophila melanogaster (fruit fly):	CG17283	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG31926	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG33128	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG6508	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Pgcl	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Caenorhabditis elegans (roundworm):	asp-7	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	asp-8	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pgc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pgc.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgc.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	MGC108380	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	20,755,002 - 20,763,220 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	20,755,002 - 20,763,220 (-)	Ensembl				GRCr8
mRatBN7.2	9	13,257,462 - 13,265,682 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,257,462 - 13,265,682 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	21,837,988 - 21,845,673 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	26,902,067 - 26,909,766 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,201,385 - 25,209,079 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,266,699 - 15,274,917 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,266,699 - 15,274,917 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,191,145 - 14,199,127 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	8,723,620 - 8,731,837 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,009,766 - 11,018,396 (-)	NCBI		Celera
RGSC_v3.1	9	8,722,923 - 8,731,141 (-)	NCBI
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

ampicillin (ISO)

antimony(0) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

choline (ISO)

chromium atom (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

fenvalerate (EXP)

folic acid (ISO)

formononetin (ISO)

fulvestrant (ISO)

L-methionine (ISO)

mercury atom (ISO)

mercury(0) (ISO)

N-nitrosodimethylamine (ISO)

nickel dichloride (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorononanoic acid (ISO)

permethrin (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

testosterone (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

digestion (IEA)

positive regulation of antibacterial peptide production (IEA,ISO)

proteolysis (IBA,IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,ISO)

Molecular Function

aspartic-type endopeptidase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

peptidase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Nucleotide sequence of a nearly full-length cDNA coding for pepsinogen of rat gastric mucosa.	Ichihara Y, etal., Eur J Biochem 1986 Nov 17;161(1):7-12.
4.	Primary structure and transcriptional regulation of rat pepsinogen C gene.	Ishihara T, etal., J Biol Chem 1989 Jun 15;264(17):10193-9.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:6743670	PMID:12759353	PMID:23376485

Genomics

Comparative Map Data

Pgc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	20,755,002 - 20,763,220 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	20,755,002 - 20,763,220 (-)	Ensembl				GRCr8
mRatBN7.2	9	13,257,462 - 13,265,682 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,257,462 - 13,265,682 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	21,837,988 - 21,845,673 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	26,902,067 - 26,909,766 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,201,385 - 25,209,079 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,266,699 - 15,274,917 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,266,699 - 15,274,917 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,191,145 - 14,199,127 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	8,723,620 - 8,731,837 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,009,766 - 11,018,396 (-)	NCBI		Celera
RGSC_v3.1	9	8,722,923 - 8,731,141 (-)	NCBI
Cytogenetic Map	9	q12	NCBI

PGC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	41,736,711 - 41,747,397 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	41,736,711 - 41,754,109 (-)	Ensembl			hg38	GRCh38
GRCh37	6	41,704,449 - 41,715,135 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	41,812,430 - 41,823,099 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	41,812,429 - 41,823,099	NCBI
Celera	6	43,257,886 - 43,268,464 (-)	NCBI		Celera
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	41,423,279 - 41,433,946 (-)	NCBI		HuRef
CHM1_1	6	41,707,932 - 41,718,508 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	41,565,267 - 41,576,000 (-)	NCBI		T2T-CHM13v2.0

Pgc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	48,037,767 - 48,045,403 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	48,037,767 - 48,045,407 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	47,726,842 - 47,734,478 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	47,726,842 - 47,734,482 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	47,863,791 - 47,871,427 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	47,190,033 - 47,197,669 (+)	NCBI		MGSCv36	mm8
Celera	17	51,163,923 - 51,171,529 (+)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	23.98	NCBI

Pgc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	8,142,661 - 8,151,339 (-)	Ensembl
ChiLan1.0	NW_004955437	8,142,523 - 8,153,044 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	56,229,793 - 56,240,297 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	52,099,801 - 52,110,296 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	41,321,932 - 41,330,494 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	42,627,385 - 42,637,514 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	42,627,222 - 42,637,514 (-)	Ensembl			panPan2	panpan1.1

PGC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	10,425,137 - 10,435,129 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	10,454,837 - 10,463,787 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	10,905,543 - 10,914,475 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	12	10,436,269 - 10,445,194 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	10,519,705 - 10,528,842 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	10,613,396 - 10,622,545 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pgc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	45,913,605 - 45,920,575 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	18,039,709 - 18,046,510 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	18,039,709 - 18,046,510 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	36,922,271 - 36,951,349 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	36,922,269 - 36,951,380 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	42,257,163 - 42,286,645 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	30,414,769 - 30,424,708 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	30,415,124 - 30,424,766 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	41,732,945 - 41,743,040 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	17,311,644 - 17,319,764 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	17,311,743 - 17,319,675 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pgc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	82,142,680 - 82,150,222 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pgc
94 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	32
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000019650
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	21707400	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
1578675	Bss17	Bone structure and strength QTL 17	3.8		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	9	3605355	21031556	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	6714888	29567695	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat

Markers in Region

BI275837

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	20,755,620 - 20,756,379 (+)	Marker Load Pipeline
mRatBN7.2	9	13,258,080 - 13,258,839 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	15,267,318 - 15,268,076	NCBI	Rnor6.0
Rnor_5.0	9	14,191,764 - 14,192,522	UniSTS	Rnor5.0
RGSC_v3.4	9	8,724,238 - 8,724,996	UniSTS	RGSC3.4
Celera	9	11,010,385 - 11,011,143	UniSTS
RH 3.4 Map	9	42.8	UniSTS
Cytogenetic Map	9	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	9	25	75	59	65	36	37	36	6	176	76	69	43	82	29	6	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X04644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019650 ⟹ ENSRNOP00000019650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	20,755,002 - 20,763,220 (-)	Ensembl
mRatBN7.2 Ensembl	9	13,257,462 - 13,265,682 (-)	Ensembl
Rnor_6.0 Ensembl	9	15,266,699 - 15,274,917 (-)	Ensembl

RefSeq Acc Id:

NM_133284 ⟹ NP_579818

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	20,755,002 - 20,763,220 (-)	NCBI
mRatBN7.2	9	13,257,462 - 13,265,682 (-)	NCBI
Rnor_6.0	9	15,266,699 - 15,274,917 (-)	NCBI
Rnor_5.0	9	14,191,145 - 14,199,127 (-)	NCBI
RGSC_v3.4	9	8,723,620 - 8,731,837 (-)	RGD
Celera	9	11,009,766 - 11,018,396 (-)	NCBI

Sequence:

show sequence

CACCGCAACGGTTGAGCTCGAAGGGATTTCTTCCTGTGAGACCAGCTGCAAACCGGCATCATGA
AGTGGATGGTAGTAGCCTTGCTCTGCCTCCCGCTCTTGGAGGCATCCCTGCTCAGGGTCCCCCT
GAGGAAAATGAAGAGTATCCGTGAGACCATGAAGGAACAGGGCGTCCTTAAAGACTTTCTGAAG
ACCCACAAATATGACCCTGGCCAGAAGTACCACTTCGGCAACTTCGGTGACTACAGTGTACTCT
ATGAGCCCATGGCCTACATGGATGCTTCCTACTTCGGTGAGATCAGCATTGGGACTCCACCCCA
GAACTTCCTGGTCCTTTTCGACACCGGCTCCTCCAACCTGTGGGTGTCTTCTGTCTACTGCCAG
AGCGAGGCCTGCACCACACACGCCCGCTTCAACCCCAGCAAGTCCTCCACTTACTACACCGAAG
GGCAGACCTTCTCCCTGCAGTACGGCACTGGCAGCCTTACTGGCTTCTTTGGCTATGACACTCT
GACCGTCCAAAGCATTCAGGTTCCCAACCAGGAGTTTGGCCTGAGTGAGAATGAGCCTGGTACC
AATTTTGTCTATGCCCAATTTGATGGCATCATGGGCCTGGCCTACCCCGGCCTGTCTTCAGGGG
GTGCCACCACCGCCTTGCAGGGCATGTTGGGGGAGGGCGCTCTCTCCCAGCCCCTCTTCGGAGT
CTACCTTGGCAGCCAGCAGGGGTCTAACGGTGGGCAGATTGTGTTTGGAGGCGTGGACAAGAAC
CTCTACACTGGGGAGATCACCTGGGTTCCTGTCACTCAGGAGCTCTACTGGCAGATTACCATTG
ACGACTTCCTCATTGGCGACCAGGCCTCTGGATGGTGCTCCTCCCAGGGCTGCCAAGGCATTGT
AGACACAGGTACCTCTCTGCTCGTCATGCCTGCCCAGTACCTCAGTGAACTTCTGCAGACCATA
GGAGCCCAGGAAGGAGAGTACGGAGAGTATTTTGTGAGCTGCGACAGTGTCAGTAGCCTGCCTA
CCCTCAGTTTCGTCCTCAATGGTGTCCAGTTCCCCCTGTCACCCTCTTCCTACATCATCCAGGA
GGACAACTTCTGCATGGTGGGTCTTGAGAGCATCTCTCTGACCTCTGAGAGTGGCCAGCCCCTC
TGGATCCTTGGGGATGTCTTCCTCAGGTCTTACTATGCCATCTTCGACATGGGCAACAACAAGG
TGGGCCTTGCCACTTCTGTCTAGACTTGCCCTCTAGACACGCCTGTGCCCTTCTTCCCCTCAGC
CTGCCTGCCCCCTCTGTTCCTCCTCTCTGCATCCAGCTTGTCTTTTCCGGACCCTAGACTTGCC
CTAATAATAAATAGTCTTCCATATTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_579818	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA28305	(Get FASTA)	NCBI Sequence Viewer
	EDM18898	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019650
	ENSRNOP00000019650.2
GenBank Protein	P04073	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_579818 ⟸ NM_133284
- Peptide Label:	precursor
- UniProtKB:	P04073 (UniProtKB/Swiss-Prot), A6JII4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKWMVVALLCLPLLEASLLRVPLRKMKSIRETMKEQGVLKDFLKTHKYDPGQKYHFGNFGDYSV LYEPMAYMDASYFGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQSEACTTHARFNPSKSSTYYT EGQTFSLQYGTGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSS GGATTALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDKNLYTGEITWVPVTQELYWQIT IDDFLIGDQASGWCSSQGCQGIVDTGTSLLVMPAQYLSELLQTIGAQEGEYGEYFVSCDSVSSL PTLSFVLNGVQFPLSPSSYIIQEDNFCMVGLESISLTSESGQPLWILGDVFLRSYYAIFDMGNN KVGLATSV hide sequence

Ensembl Acc Id:

ENSRNOP00000019650 ⟸ ENSRNOT00000019650

Protein Domains

Peptidase A1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04073-F1-model_v2	AlphaFold	P04073	1-392	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696492

Promoter ID:

EPDNEW_R7017

Type:

multiple initiation site

Name:

Pgc_1

Description:

progastricsin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	15,274,921 - 15,274,981	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3943	AgrOrtholog
BioCyc Gene	G2FUF-28282	BioCyc
Ensembl Genes	ENSRNOG00000014492	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019650	ENTREZGENE
	ENSRNOT00000019650.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.70.10	UniProtKB/Swiss-Prot
	6.10.140.60	UniProtKB/Swiss-Prot
InterPro	Aspartic_peptidase_A1	UniProtKB/Swiss-Prot
	Aspartic_peptidase_AS	UniProtKB/Swiss-Prot
	Aspartic_peptidase_N	UniProtKB/Swiss-Prot
	PEPTIDASE_A1	UniProtKB/Swiss-Prot
	Peptidase_aspartic_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:24864	UniProtKB/Swiss-Prot
NCBI Gene	24864	ENTREZGENE
PANTHER	BETA-SITE APP-CLEAVING ENZYME, ISOFORM A-RELATED	UniProtKB/Swiss-Prot
	GASTRICSIN	UniProtKB/Swiss-Prot
Pfam	A1_Propeptide	UniProtKB/Swiss-Prot
	Asp	UniProtKB/Swiss-Prot
PhenoGen	Pgc	PhenoGen
PRINTS	PEPSIN	UniProtKB/Swiss-Prot
PROSITE	ASP_PROTEASE	UniProtKB/Swiss-Prot
	PEPTIDASE_A1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014492	RatGTEx
Superfamily-SCOP	SSF50630	UniProtKB/Swiss-Prot
UniProt	A6JII4	ENTREZGENE, UniProtKB/TrEMBL
	P04073	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-10	Pgc	progastricsin	Pgc	progastricsin (pepsinogen C)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Pgc	progastricsin (pepsinogen C)		progastricsin	Name updated	1299863	APPROVED
2003-04-09	Pgc	progastricsin		progastricsin (pepsinogen C)	Name updated	629478	APPROVED
2002-02-27	Pgc	progastricsin (pepsinogen C)			Name updated to reflect Human and Mouse nomenclature	70292	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	induced during development, and by hydrocortisone	633690
gene_transcript	contains 9 exons	633690

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message