Symbol:
Sstr2
Name:
somatostatin receptor 2
RGD ID:
3763
Description:
Enables PDZ domain binding activity and somatostatin receptor activity. Involved in several processes, including brain development; cellular response to estradiol stimulus; and peristalsis. Predicted to be located in cytosol; membrane; and nucleoplasm. Predicted to be part of G protein-coupled receptor heterodimeric complex. Predicted to be active in neuron projection and plasma membrane. Orthologous to human SSTR2 (somatostatin receptor 2); INTERACTS WITH (+)-pilocarpine; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Smstr2; somatostatin receptor subtype 2; somatostatin receptor type 2; somatotropin release-inhibiting factor receptor; SRIF-1; SS-2-R; SS2-R; SS2R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SSTR2 (somatostatin receptor 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Sstr2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sstr2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SSTR2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SSTR2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sstr2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SSTR2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SSTR2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sstr2 (somatostatin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SSTR2 (somatostatin receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sstr2 (somatostatin receptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sstr2b (somatostatin receptor 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
sstr2a (somatostatin receptor 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
AstC-R1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
npr-24
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
AstC-R2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sstr2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 99,163,353 - 99,170,519 (+) NCBI GRCr8 mRatBN7.2 10 98,664,204 - 98,671,370 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 98,664,216 - 98,674,351 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 103,716,316 - 103,723,467 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 103,179,358 - 103,186,509 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 98,584,256 - 98,591,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 102,136,283 - 102,143,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 102,136,283 - 102,143,434 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 101,816,029 - 101,823,337 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 103,246,880 - 103,254,444 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 103,261,249 - 103,268,805 (+) NCBI Celera 10 97,271,562 - 97,278,691 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sstr2 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of SSTR2 protein CTD PMID:18951627 Sstr2 Rat 17alpha-ethynylestradiol increases expression ISO Sstr2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SSTR2 mRNA CTD PMID:17942748 Sstr2 Rat 17alpha-ethynylestradiol multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SSTR2 mRNA CTD PMID:17942748 Sstr2 Rat 17alpha-ethynylestradiol affects expression ISO Sstr2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SSTR2 mRNA CTD PMID:17555576 Sstr2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SSTR2 mRNA CTD PMID:17942748 Sstr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SSTR2 mRNA CTD PMID:32109520 Sstr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sstr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SSTR2 mRNA CTD PMID:17942748 Sstr2 Rat 3',5'-cyclic AMP multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [64Cu-CB-TE2A-Y3-TATE co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] and [SST protein co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] CTD PMID:22056254 Sstr2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Sstr2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SSTR2 mRNA CTD PMID:19285098 Sstr2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Sstr2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SSTR2 mRNA CTD PMID:18648102 Sstr2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of SSTR2 mRNA CTD PMID:24780913 Sstr2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SSTR2 mRNA CTD PMID:30047161 Sstr2 Rat aflatoxin B1 decreases expression ISO Sstr2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SSTR2 mRNA CTD PMID:19770486 Sstr2 Rat aflatoxin B1 increases methylation ISO SSTR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SSTR2 exon CTD PMID:30157460 Sstr2 Rat all-trans-retinoic acid decreases expression ISO SSTR2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SSTR2 mRNA CTD PMID:21934132 and PMID:23724009 Sstr2 Rat all-trans-retinoic acid increases expression ISO Sstr2 (Mus musculus) 6480464 Tretinoin results in increased expression of SSTR2 mRNA CTD PMID:36189433 Sstr2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SSTR2 mRNA CTD PMID:30047161 Sstr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SSTR2 mRNA CTD PMID:16483693 Sstr2 Rat aristolochic acid A increases expression ISO SSTR2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SSTR2 mRNA CTD PMID:33212167 Sstr2 Rat arsenous acid decreases expression ISO SSTR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SSTR2 mRNA CTD PMID:26705709 Sstr2 Rat atrazine affects expression ISO Sstr2 (Mus musculus) 6480464 Atrazine affects the expression of SSTR2 mRNA CTD PMID:16221967 Sstr2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of SSTR2 gene CTD PMID:28931070 Sstr2 Rat atrazine increases expression ISO SSTR2 (Homo sapiens) 6480464 Atrazine results in increased expression of SSTR2 mRNA CTD PMID:22378314 Sstr2 Rat benzo[a]pyrene decreases expression ISO Sstr2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SSTR2 mRNA CTD PMID:19770486 Sstr2 Rat benzo[a]pyrene increases methylation ISO SSTR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SSTR2 5' UTR more ... CTD PMID:27901495 Sstr2 Rat benzo[a]pyrene affects methylation ISO SSTR2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SSTR2 exon CTD PMID:30157460 Sstr2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SSTR2 mRNA CTD PMID:15620428 Sstr2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sstr2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SSTR2 mRNA CTD PMID:35818324 Sstr2 Rat bisphenol A multiple interactions EXP 6480464 bisphenol A promotes the reaction [SST binds to SSTR2 protein alternative form] more ... CTD PMID:12060835 Sstr2 Rat bisphenol A decreases expression ISO Sstr2 (Mus musculus) 6480464 bisphenol A results in decreased expression of SSTR2 mRNA CTD PMID:32156529 Sstr2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SSTR2 gene CTD PMID:28505145 Sstr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SSTR2 mRNA CTD PMID:25181051 Sstr2 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of SSTR2 mRNA CTD PMID:15808516 Sstr2 Rat butanal increases expression ISO SSTR2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of SSTR2 mRNA CTD PMID:26079696 Sstr2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of SSTR2 mRNA CTD PMID:19167457 Sstr2 Rat cadmium atom increases expression ISO SSTR2 (Homo sapiens) 6480464 Cadmium results in increased expression of SSTR2 mRNA CTD PMID:21694771 Sstr2 Rat cadmium dichloride decreases expression ISO SSTR2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SSTR2 mRNA CTD PMID:38382870 Sstr2 Rat celecoxib increases expression ISO SSTR2 (Homo sapiens) 6480464 Celecoxib results in increased expression of SSTR2 protein CTD PMID:17959037 Sstr2 Rat CGP 52608 multiple interactions ISO SSTR2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SSTR2 gene] CTD PMID:28238834 Sstr2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SSTR2 mRNA CTD PMID:20682304 Sstr2 Rat ciguatoxin CTX1B affects expression ISO Sstr2 (Mus musculus) 6480464 Ciguatoxins affects the expression of SSTR2 mRNA CTD PMID:18353800 Sstr2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of SSTR2 mRNA CTD PMID:20187946 Sstr2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of SSTR2 mRNA CTD PMID:27899881 Sstr2 Rat colforsin daropate hydrochloride multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [64Cu-CB-TE2A-Y3-TATE co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] and [SST protein co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] CTD PMID:22056254 Sstr2 Rat crocidolite asbestos decreases expression ISO SSTR2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of SSTR2 mRNA CTD PMID:29523930 Sstr2 Rat cyclosporin A increases expression ISO Sstr2 (Mus musculus) 6480464 Cyclosporine results in increased expression of SSTR2 mRNA CTD PMID:19770486 Sstr2 Rat diarsenic trioxide decreases expression ISO SSTR2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SSTR2 mRNA CTD PMID:26705709 Sstr2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SSTR2 mRNA CTD PMID:15620428 Sstr2 Rat dioxygen multiple interactions ISO Sstr2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SSTR2 mRNA CTD PMID:30529165 Sstr2 Rat dorsomorphin multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sstr2 Rat entinostat increases expression ISO SSTR2 (Homo sapiens) 6480464 entinostat results in increased expression of SSTR2 mRNA CTD PMID:26272509 Sstr2 Rat entinostat multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SSTR2 mRNA CTD PMID:27188386 Sstr2 Rat epoxiconazole increases expression ISO Sstr2 (Mus musculus) 6480464 epoxiconazole results in increased expression of SSTR2 mRNA CTD PMID:35436446 Sstr2 Rat ethanol affects expression ISO Sstr2 (Mus musculus) 6480464 Ethanol affects the expression of SSTR2 mRNA CTD PMID:30319688 Sstr2 Rat ethyl methanesulfonate decreases expression ISO SSTR2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SSTR2 mRNA CTD PMID:23649840 Sstr2 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of SSTR2 mRNA CTD PMID:18035473 Sstr2 Rat folic acid increases expression ISO Sstr2 (Mus musculus) 6480464 Folic Acid results in increased expression of SSTR2 mRNA CTD PMID:25006883 Sstr2 Rat fonofos increases methylation ISO SSTR2 (Homo sapiens) 6480464 Fonofos results in increased methylation of SSTR2 promoter CTD PMID:22847954 Sstr2 Rat formaldehyde increases expression ISO SSTR2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SSTR2 mRNA CTD PMID:23649840 Sstr2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of SSTR2 gene CTD PMID:22079235 Sstr2 Rat furan increases expression EXP 6480464 furan results in increased expression of SSTR2 mRNA CTD PMID:25539665 Sstr2 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of SSTR2 mRNA CTD PMID:24915197 Sstr2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of SSTR2 mRNA CTD PMID:29933104 Sstr2 Rat hydrogen chloride affects response to substance ISO Sstr2 (Mus musculus) 6480464 SSTR2 protein affects the susceptibility to Hydrochloric Acid CTD PMID:17363388 Sstr2 Rat inulin multiple interactions ISO Sstr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SSTR2 mRNA CTD PMID:36331819 Sstr2 Rat lanreotide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with lanreotide] results in increased expression of SSTR2 mRNA CTD PMID:19874807 Sstr2 Rat lipopolysaccharide multiple interactions ISO SSTR2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SSTR2 mRNA] CTD PMID:35811015 Sstr2 Rat lipopolysaccharide increases expression ISO SSTR2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of SSTR2 mRNA CTD PMID:35811015 Sstr2 Rat malathion increases expression ISO SSTR2 (Homo sapiens) 6480464 Malathion results in increased expression of SSTR2 mRNA CTD PMID:37047231 Sstr2 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of SSTR2 mRNA CTD PMID:19564919 Sstr2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SSTR2 mRNA CTD PMID:30047161 Sstr2 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of SSTR2 gene CTD PMID:23303685 Sstr2 Rat methyl methanesulfonate decreases expression ISO SSTR2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SSTR2 mRNA CTD PMID:23649840 Sstr2 Rat methylmercury chloride increases expression ISO SSTR2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SSTR2 mRNA CTD PMID:28001369 Sstr2 Rat metronidazole multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SSTR2 mRNA] CTD PMID:36535435 Sstr2 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SSTR2 mRNA CTD PMID:28801915 Sstr2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with lanreotide] results in increased expression of SSTR2 mRNA CTD PMID:19874807 Sstr2 Rat neomycin multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SSTR2 mRNA] CTD PMID:36535435 Sstr2 Rat octreotide increases activity ISO SSTR2 (Homo sapiens) 6480464 [Octreotide results in increased activity of SSTR2 protein] which results in increased activity of CASP3 protein CTD PMID:16954443 Sstr2 Rat octreotide multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [Octreotide results in increased activity of SSTR2 protein] which results in increased expression of KRT18 protein modified form CTD PMID:16954443 Sstr2 Rat octreotide affects response to substance ISO Sstr2 (Mus musculus) 6480464 SSTR2 protein affects the susceptibility to Octreotide CTD PMID:17363388 Sstr2 Rat parathion increases methylation ISO SSTR2 (Homo sapiens) 6480464 Parathion results in increased methylation of SSTR2 promoter CTD PMID:22847954 Sstr2 Rat pasireotide affects binding ISO SSTR2 (Homo sapiens) 6480464 pasireotide binds to SSTR2 protein CTD PMID:16625840 Sstr2 Rat pentanal increases expression ISO SSTR2 (Homo sapiens) 6480464 pentanal results in increased expression of SSTR2 mRNA CTD PMID:26079696 Sstr2 Rat perfluorohexanesulfonic acid increases expression ISO Sstr2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SSTR2 mRNA CTD PMID:37995155 Sstr2 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of SSTR2 mRNA CTD PMID:20136073 Sstr2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sstr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SSTR2 mRNA CTD PMID:36331819 Sstr2 Rat permethrin decreases expression ISO SSTR2 (Homo sapiens) 6480464 Permethrin results in decreased expression of SSTR2 mRNA CTD PMID:37047231 Sstr2 Rat phenylmercury acetate decreases expression ISO SSTR2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SSTR2 mRNA CTD PMID:26272509 Sstr2 Rat phenylmercury acetate multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SSTR2 mRNA CTD PMID:27188386 Sstr2 Rat picrotoxin increases expression EXP 6480464 Picrotoxin results in increased expression of SSTR2 mRNA CTD PMID:15170462 Sstr2 Rat propanal increases expression ISO SSTR2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of SSTR2 mRNA CTD PMID:26079696 Sstr2 Rat rotenone affects expression ISO SSTR2 (Homo sapiens) 6480464 Rotenone affects the expression of SSTR2 mRNA CTD PMID:29428530 Sstr2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SSTR2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SSTR2 mRNA] CTD PMID:35811015 Sstr2 Rat SB 431542 multiple interactions ISO SSTR2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sstr2 Rat silicon dioxide increases expression ISO SSTR2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of SSTR2 mRNA CTD PMID:23806026 Sstr2 Rat sodium arsenite increases expression ISO Sstr2 (Mus musculus) 6480464 sodium arsenite results in increased expression of SSTR2 mRNA CTD PMID:37682722 Sstr2 Rat somatostatin increases expression ISO SSTR2 (Homo sapiens) 6480464 Somatostatin results in increased expression of SSTR2 mRNA CTD PMID:18575731 Sstr2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SSTR2 mRNA CTD PMID:30047161 Sstr2 Rat tamoxifen affects expression ISO Sstr2 (Mus musculus) 6480464 Tamoxifen affects the expression of SSTR2 mRNA CTD PMID:17555576 Sstr2 Rat terbufos increases methylation ISO SSTR2 (Homo sapiens) 6480464 terbufos results in increased methylation of SSTR2 promoter CTD PMID:22847954 Sstr2 Rat tetrachloromethane increases expression ISO Sstr2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SSTR2 mRNA CTD PMID:31919559 Sstr2 Rat titanium dioxide decreases methylation ISO Sstr2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SSTR2 promoter CTD PMID:35295148 Sstr2 Rat triadimefon increases expression ISO SSTR2 (Homo sapiens) 6480464 triadimefon results in increased expression of SSTR2 mRNA CTD PMID:26705709 Sstr2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SSTR2 mRNA CTD PMID:33387578 Sstr2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SSTR2 mRNA CTD PMID:23665938 Sstr2 Rat valproic acid increases expression ISO SSTR2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SSTR2 mRNA CTD PMID:23179753 more ... Sstr2 Rat valproic acid affects expression ISO SSTR2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SSTR2 mRNA CTD PMID:25979313 Sstr2 Rat valproic acid decreases expression ISO SSTR2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SSTR2 mRNA CTD PMID:23527032 Sstr2 Rat vancomycin multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SSTR2 mRNA] CTD PMID:36535435 Sstr2 Rat vincristine increases expression ISO SSTR2 (Homo sapiens) 6480464 Vincristine results in increased expression of SSTR2 mRNA CTD PMID:23649840 Sstr2 Rat zinc oxide multiple interactions ISO Sstr2 (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SSTR2 mRNA] CTD PMID:36535435 Sstr2 Rat zinc oxide increases expression ISO Sstr2 (Mus musculus) 6480464 Zinc Oxide analog results in increased expression of SSTR2 mRNA CTD PMID:36535435 Sstr2 Rat zolpidem multiple interactions EXP 6480464 zolpidem promotes the reaction [bisphenol A promotes the reaction [SST binds to SSTR2 protein alternative form]] and zolpidem promotes the reaction [SST binds to SSTR2 protein alternative form] CTD PMID:12060835
(+)-pilocarpine (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bleomycin A2 (EXP) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) celecoxib (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) ciguatoxin CTX1B (ISO) cocaine (EXP) colforsin daropate hydrochloride (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) flavonoids (EXP) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) furan (EXP) glycidol (EXP) graphite (EXP) hydrogen chloride (ISO) inulin (ISO) lanreotide (EXP) lipopolysaccharide (ISO) malathion (ISO) methamphetamine (EXP) methimazole (EXP) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) metronidazole (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) neomycin (ISO) octreotide (ISO) parathion (ISO) pasireotide (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) permethrin (ISO) phenylmercury acetate (ISO) picrotoxin (EXP) propanal (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) somatostatin (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) terbufos (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vincristine (ISO) zinc oxide (ISO) zolpidem (EXP)
1.
Somatostatin sst(2) receptors inhibit peristalsis in the rat and mouse jejunum.
Abdu F, etal., Am J Physiol Gastrointest Liver Physiol 2002 Apr;282(4):G624-33.
2.
Gain of chromosome arm 17q is associated with unfavourable prognosis in neuroblastoma, but does not involve mutations in the somatostatin receptor 2(SSTR2) gene at 17q24.
Abel F, etal., Br J Cancer 1999 Dec;81(8):1402-9.
3.
Identification of multiple somatostatin receptors in the rat somatosensory cortex during development.
Bologna E and Leroux P, J Comp Neurol. 2000 May 15;420(4):466-80.
4.
Expression changes of somatostatin receptor subtypes sst2A, sst2B, sst3 and sst4 after a cortical contusion trauma in rats.
Braun H, etal., Brain Res. 2002 Mar 15;930(1-2):191-9.
5.
Pituitary and hypothalamic somatostatin receptor subtype messenger ribonucleic acid expression in the food-deprived and diabetic rat.
Bruno JF, etal., Endocrinology. 1994 Nov;135(5):1787-92.
6.
Intra-islet somatostatin regulates glucagon release via type 2 somatostatin receptors in rats.
Cejvan K, etal., Diabetes 2003 May;52(5):1176-81.
7.
Inhibitory control of growth hormone secretion by somatostatin in rat pituitary GC cells: sst(2) but not sst(1) receptors are coupled to inhibition of single-cell intracellular free calcium concentrations.
Cervia D, etal., Neuroendocrinology 2002 Aug;76(2):99-110.
8.
Effect of 17beta-estradiol on somatostatin receptor expression and inhibitory effects on growth hormone and prolactin release in rat pituitary cell cultures.
Djordjijevic D, etal., Endocrinology. 1998 May;139(5):2272-7.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Expression cloning of a rat brain somatostatin receptor cDNA.
Kluxen FW, etal., Proc Natl Acad Sci U S A 1992 May 15;89(10):4618-22.
11.
Identification of proteins interacting with the rat somatostatin receptor subtype 2.
Kreienkamp HJ, etal., J Physiol Paris. 2000 May-Aug;94(3-4):193-8.
12.
Expression of the five somatostatin receptor (SSTR1-5) subtypes in rat pituitary somatotrophes: quantitative analysis by double-layer immunofluorescence confocal microscopy.
Kumar U, etal., Endocrinology. 1997 Oct;138(10):4473-6.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Role of glucocorticoids in the regulation of pituitary somatostatin receptor subtype (sst1-sst5) mRNA levels: evidence for direct and somatostatin-mediated effects.
Park S, etal., Neuroendocrinology. 2003 Sep;78(3):163-75.
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Somatostatin immunoreactivity in axon terminals in rat nucleus tractus solitarii arising from central nucleus of amygdala: coexistence with GABA and postsynaptic expression of sst2A receptor.
Saha S, etal., J Chem Neuroanat 2002 Jun;24(1):1-13.
18.
Spinal somatostatin SSTR2A receptors are preferentially up-regulated and involved in thermonociception but not mechanonociception.
Song P, etal., Exp Neurol 2002 Dec;178(2):280-7.
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.
Differential expression of multiple somatostatin receptors in the rat cerebellum during development.
Viollet C, etal., J Neurochem. 1997 Jun;68(6):2263-72.
21.
Differential gene expression in the rat caudate putamen after "binge" cocaine administration: advantage of triplicate microarray analysis.
Yuferov V, etal., Synapse 2003 Jun 15;48(4):157-69.
22.
The localization of messenger ribonucleic acids for somatostatin receptors 1, 2, and 3 in rat testis.
Zhu LJ, etal., Endocrinology. 1998 Jan;139(1):350-7.
23.
Somatostatin receptor interacting protein defines a novel family of multidomain proteins present in human and rodent brain.
Zitzer H, etal., J Biol Chem. 1999 Nov 12;274(46):32997-3001.
Sstr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 99,163,353 - 99,170,519 (+) NCBI GRCr8 mRatBN7.2 10 98,664,204 - 98,671,370 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 98,664,216 - 98,674,351 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 103,716,316 - 103,723,467 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 103,179,358 - 103,186,509 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 98,584,256 - 98,591,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 102,136,283 - 102,143,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 102,136,283 - 102,143,434 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 101,816,029 - 101,823,337 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 103,246,880 - 103,254,444 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 103,261,249 - 103,268,805 (+) NCBI Celera 10 97,271,562 - 97,278,691 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
SSTR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 73,165,010 - 73,176,633 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 73,165,010 - 73,176,633 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 71,161,149 - 71,172,772 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 68,672,755 - 68,679,689 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 68,672,754 - 68,679,655 NCBI Celera 17 67,744,235 - 67,751,169 (+) NCBI Celera Cytogenetic Map 17 q25.1 NCBI HuRef 17 66,570,255 - 66,577,187 (+) NCBI HuRef CHM1_1 17 71,225,325 - 71,232,224 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 74,054,801 - 74,066,425 (+) NCBI T2T-CHM13v2.0
Sstr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 113,510,153 - 113,516,854 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 113,510,168 - 113,516,854 (+) Ensembl GRCm39 Ensembl GRCm38 11 113,619,327 - 113,626,028 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 113,619,342 - 113,626,028 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 113,485,571 - 113,486,950 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 113,435,574 - 113,441,985 (+) NCBI MGSCv36 mm8 Celera 11 125,379,798 - 125,381,177 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 79.05 NCBI
Sstr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 60,489 - 90,209 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 61,126 - 123,806 (-) NCBI ChiLan1.0 ChiLan1.0
SSTR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 89,182,442 - 89,194,105 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 94,007,294 - 94,018,946 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 67,093,013 - 67,099,086 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 72,549,167 - 72,556,106 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 72,553,506 - 72,554,615 (+) Ensembl panpan1.1 panPan2
SSTR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 6,989,488 - 7,004,851 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 6,996,874 - 7,000,778 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 7,620,598 - 7,621,707 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 7,662,314 - 7,677,653 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 9 7,712,309 - 7,713,418 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 7,815,153 - 7,816,262 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 7,876,175 - 7,877,284 (-) NCBI UU_Cfam_GSD_1.0
Sstr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 7,552,830 - 7,558,761 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936655 1,051,447 - 1,052,556 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936655 1,050,835 - 1,056,609 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SSTR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 7,783,431 - 7,789,488 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 7,783,401 - 7,789,483 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 8,063,456 - 8,069,876 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SSTR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 48,462,472 - 48,470,586 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 48,464,342 - 48,465,451 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 19,280,096 - 19,290,449 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sstr2
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 77 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000003734, ENSRNOT00000003735 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 70168 Eae12 Experimental allergic encephalomyelitis QTL 12 0.0009 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 92238497 101012337 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 1576313 Pia25 Pristane induced arthritis QTL 25 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 96120911 104060283 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576307 Cia28 Collagen induced arthritis QTL 28 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 96120911 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 631539 Oia6 Oil induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 97010147 104670812 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 61436 Cia5 Collagen induced arthritis QTL 5 4.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 91228102 104060283 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
AU047965
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 98,665,236 - 98,665,482 (+) MAPPER mRatBN7.2 Rnor_6.0 10 102,137,316 - 102,137,561 NCBI Rnor6.0 Rnor_5.0 10 101,817,062 - 101,817,307 UniSTS Rnor5.0 RGSC_v3.4 10 103,247,913 - 103,248,158 UniSTS RGSC3.4 Celera 10 97,272,595 - 97,272,840 UniSTS Cytogenetic Map 10 q32.1 UniSTS
SSTR2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 98,669,935 - 98,670,339 (+) MAPPER mRatBN7.2 Rnor_6.0 10 102,142,015 - 102,142,418 NCBI Rnor6.0 Rnor_5.0 10 101,821,903 - 101,822,306 UniSTS Rnor5.0 RGSC_v3.4 10 103,253,010 - 103,253,413 UniSTS RGSC3.4 Celera 10 97,277,257 - 97,277,660 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
22
113
78
77
46
24
46
6
169
66
93
42
56
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003735 ⟹ ENSRNOP00000003735
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 98,664,357 - 98,671,080 (+) Ensembl Rnor_6.0 Ensembl 10 102,136,283 - 102,143,434 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116317 ⟹ ENSRNOP00000094133
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 98,664,216 - 98,674,351 (+) Ensembl
RefSeq Acc Id:
NM_019348 ⟹ NP_062221
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 99,163,353 - 99,170,519 (+) NCBI mRatBN7.2 10 98,664,204 - 98,671,370 (+) NCBI Rnor_6.0 10 102,136,283 - 102,143,449 (+) NCBI Rnor_5.0 10 101,816,029 - 101,823,337 (+) NCBI RGSC_v3.4 10 103,246,880 - 103,254,444 (+) RGD Celera 10 97,271,562 - 97,278,691 (+) RGD
Sequence:
GCCACCGGCACGCTGGCGAGGCCACCGGCCCTGGAGCACCAGTCCGCCGCTGGGCGTCGATGATCTACAGGCCAGGGTAGCTCTACTGGGGCCCAGGCAAGCTCTCTCAGACGCCAGGAGGGCCAGCA
hide sequence
RefSeq Acc Id:
NP_062221 ⟸ NM_019348
- UniProtKB:
P30680 (UniProtKB/Swiss-Prot), A6HKG0 (UniProtKB/TrEMBL), A6HKF9 (UniProtKB/TrEMBL)
- Sequence:
MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFT
hide sequence
Ensembl Acc Id:
ENSRNOP00000003735 ⟸ ENSRNOT00000003735
Ensembl Acc Id:
ENSRNOP00000094133 ⟸ ENSRNOT00000116317
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Sstr2
somatostatin receptor 2
Symbol and Name updated
629477 APPROVED
2003-03-12
Sstr2
somatostatin receptor 2
Smstr2
somatostatin receptor 2
Data merged from RGD:620193
628472 PROVISIONAL
2002-08-07
Smstr2
somatostatin receptor 2
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Sstr2
somatostatin receptor subtype 2
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in brain cortex and hippocampus
70025
gene_physical_interaction
binds to somatotropin release-inhibiting factor (SRIF)
70025
gene_process
inhibits peristalsis in the jejunum upon binding to somatostatin
737668
gene_process
may modulate activity of neurons in nucleus tractus solitarii from the central nucleus of the amygdala in response to fear or emotional stimuli
730237
gene_process
activation with somatostatin inhibits release of glucagon but not insulin in islets
1299053
gene_product
putative transmembrane G-protein coupled receptor
70025
