Advanced Search (OLGA)

Gene: Slc9a3 (solute carrier family 9 member A3) Rattus norvegicus

Analyze

Symbol:

Slc9a3

Name:

solute carrier family 9 member A3

RGD ID:

3720

Description:

Enables sodium:proton antiporter activity. Involved in several processes, including regulation of sodium ion transport; response to glucocorticoid; and sodium ion transport. Located in brush border membrane and recycling endosome membrane. Used to study hypertension. Biomarker of obesity and renovascular hypertension. Human ortholog(s) of this gene implicated in congenital secretory sodium diarrhea 8. Orthologous to human SLC9A3 (solute carrier family 9 member A3); PARTICIPATES IN endothelin signaling pathway; bile acid transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

na(+)/H(+) exchanger 3; NHE-3; Nhe3; plasma membrane ion transport protein; sodium/hydrogen exchanger 3; Solute carrier family 9 (sodium/hydrogen exchanger 3) antiporter 3 Na+/H+ (amiloride insensitive); Solute carrier family 9 (sodium/hydrogen exchanger 3), antiporter 3, Na+/H+ (amiloride insensitive); solute carrier family 9 (sodium/hydrogen exchanger), member 3; solute carrier family 9 member 3; solute carrier family 9, member 3; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC9A3 (solute carrier family 9 member A3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc9a3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100988373 (LINE-1 retrotransposable element ORF2 protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC9A3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc9a3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC9A3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC9A3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc9a3 (solute carrier family 9 member A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SH3BP5L (SH3 binding domain protein 5 like)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC9A3 (solute carrier family 9 member A3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc9a3.2 (solute carrier family 9 member A3, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Nhe2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Nhe2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nhx-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nhx-3	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nhx-6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nhx-9	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc9a3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc9a3	Alliance	DIOPT (OrthoFinder\|PANTHER)

Candidate Gene For:

Bp95

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	30,953,215 - 30,996,209 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	30,953,216 - 30,996,002 (-)	Ensembl				GRCr8
mRatBN7.2	1	29,124,633 - 29,167,912 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	29,124,674 - 29,167,417 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	28,926,541 - 28,969,373 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	34,926,400 - 34,969,224 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	29,127,163 - 29,169,987 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	31,731,652 - 31,777,144 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	31,734,327 - 31,777,070 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	33,159,607 - 33,201,753 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	29,930,908 - 29,973,686 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	27,776,582 - 27,819,219 (-)	NCBI		Celera
RGSC_v3.1	1	29,933,852 - 29,976,631 (-)	NCBI
Cytogenetic Map	1	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

chronic kidney disease (IMP)

congenital secretory sodium diarrhea 8 (ISO)

diarrhea (ISO)

Edema (ISO)

Experimental Diabetes Mellitus (IDA,ISO)

genetic disease (ISO)

hypertension (IDA)

Hypotension (ISO)

intestinal obstruction (ISO)

Left Ventricular Hypertrophy (IMP)

malignant renovascular hypertension (IEP,IMP)

obesity (IEP)

renovascular hypertension (IEP)

schizophrenia (ISO)

sleep apnea (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acrylamide (EXP,ISO)

aldosterone (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP,ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

captopril (EXP)

chlorothalonil (ISO)

choline (ISO)

cimetidine (EXP)

cisplatin (ISO)

clofibrate (EXP)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

DDT (ISO)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

dimethylarsinic acid (ISO)

enilconazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

GW 4064 (ISO)

hydrogencarbonate (EXP)

indometacin (EXP)

L-methionine (ISO)

lithium atom (EXP)

lithium hydride (EXP)

losartan (ISO)

mercury dichloride (EXP)

methapyrilene (ISO)

methylarsonic acid (ISO)

mono(2-ethylhexyl) phthalate (ISO)

naphthalene (EXP)

perfluorooctane-1-sulfonic acid (EXP)

piperine (EXP)

procymidone (ISO)

reactive nitrogen species (EXP)

reactive oxygen species (EXP)

resveratrol (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

SKF 38393 (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium atom (EXP)

sodium chloride (ISO)

sotorasib (ISO)

Sunset Yellow FCF (ISO)

tamoxifen (ISO)

tetrachloromethane (EXP)

thallium atom (EXP)

thallium sulfate (EXP)

titanium dioxide (ISO)

trametinib (ISO)

tunicamycin (ISO)

valproic acid (EXP,ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

circadian rhythm (IEP)

intracellular sodium ion homeostasis (IEA,ISO)

monoatomic cation transport (IEA)

monoatomic ion transport (IEA)

potassium ion transmembrane transport (IBA)

proton transmembrane transport (IEA)

receptor-mediated endocytosis (IMP)

regulation of intracellular pH (IBA,IEA,ISO)

regulation of pH (IEA,ISO)

regulation of sodium ion transport (IMP)

response to glucocorticoid (IEP)

sodium ion import across plasma membrane (IBA,IEA,ISO,ISS)

sodium ion transmembrane transport (IEA)

sodium ion transport (IDA,IEA,ISO)

transmembrane transport (IEA)

Cellular Component

apical plasma membrane (IDA,IEA,ISO)

brush border (IDA)

brush border membrane (IBA,IDA,ISO)

cation-transporting ATPase complex (IEA,ISO)

early endosome (IEA,ISO)

early endosome membrane (IEA)

extracellular exosome (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO,ISS)

recycling endosome membrane (IDA,IEA,ISO)

vesicle (ISO)

Molecular Function

antiporter activity (IEA)

identical protein binding (IEA,ISO,ISS)

PDZ domain binding (ISO,ISS)

phosphatidylinositol binding (IEA,ISO,ISS)

potassium:proton antiporter activity (IBA)

protein binding (IPI,ISO)

sodium:proton antiporter activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

bile acid transport pathway (IEA)

endothelin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A role of intestine in hypertension: mechanism of suppression of intestinal Na-H exchanger isoform-3 in spontaneously hypertensive rats.	Abu-Ghefreh A and Khan I, Clin Exp Hypertens. 2013;35(7):543-9. doi: 10.3109/10641963.2013.764888. Epub 2013 Feb 12.
2.	The epithelial sodium-hydrogen antiporter Na+/H+ exchanger 3 accumulates and is functional in recycling endosomes.	D'Souza S, etal., J Biol Chem. 1998 Jan 23;273(4):2035-43. doi: 10.1074/jbc.273.4.2035.
3.	Prenatal programming of rat proximal tubule Na+/H+ exchanger by dexamethasone.	Dagan A, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Mar;292(3):R1230-5. Epub 2006 Nov 9.
4.	Effect of angiotensin-II on renal Na+/H+ exchanger-NHE3 and NHE2.	Dixit MP, etal., Biochim Biophys Acta. 2004 Jul 1;1664(1):38-44.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	NHE3 Na+/H+ exchanger supports proximal tubular protein reabsorption in vivo.	Gekle M, etal., Am J Physiol Renal Physiol. 2004 Sep;287(3):F469-73. Epub 2004 Apr 27.
7.	Upregulation of NHE3 is associated with compensatory cell growth response in young uninephrectomized rats.	Girardi AC, etal., Am J Physiol Renal Physiol 2002 Dec;283(6):F1296-303.
8.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
9.	Shank2 associates with and regulates Na+/H+ exchanger 3.	Han W, etal., J Biol Chem. 2006 Jan 20;281(3):1461-9. Epub 2005 Nov 17.
10.	Activation of Na+/H+ exchanger NHE3 by angiotensin II is mediated by inositol 1,4,5-triphosphate (IP3) receptor-binding protein released with IP3 (IRBIT) and Ca2+/calmodulin-dependent protein kinase II.	He P, etal., J Biol Chem. 2010 Sep 3;285(36):27869-78. doi: 10.1074/jbc.M110.133066. Epub 2010 Jun 28.
11.	Calcineurin homologous protein isoform 2 (CHP2), Na+/H+ exchangers-binding protein, is expressed in intestinal epithelium.	Inoue H, etal., Biol Pharm Bull 2003 Feb;26(2):148-55.
12.	Altered expression of Na(+)/H(+) exchanger isoforms 1 and 3 in clipped and unclipped kidneys of a 2-kidney-1-clip Goldblatt model of hypertension.	Khan I, etal., Nephron 2002 Oct;92(2):346-55.
13.	Demonstration of a functional apical sodium hydrogen exchanger in isolated rat gastric glands.	Kirchhoff P, etal., Am J Physiol Gastrointest Liver Physiol. 2003 Dec;285(6):G1242-8. Epub 2003 Aug 7.
14.	Acute and Chronic Regulation of the Renal Na/H(+) Exchanger NHE3 in Rats with STZ-Induced Diabetes mellitus.	Klisic J, etal., Nephron Physiol. 2005 Oct 19;102(2):p27-p35.
15.	BetaPix up-regulates Na+/H+ exchanger 3 through a Shank2-mediated protein-protein interaction.	Lee JS, etal., J Biol Chem. 2010 Mar 12;285(11):8104-13. doi: 10.1074/jbc.M109.055079. Epub 2010 Jan 14.
16.	Angiotensin II clamp prevents the second step in renal apical NHE3 internalization during acute hypertension.	Leong PK, etal., Am J Physiol Renal Physiol 2002 Nov;283(5):F1142-50.
17.	Metabolic acidosis in rats increases intestinal NHE2 and NHE3 expression and function.	Lucioni A, etal., Am J Physiol Gastrointest Liver Physiol 2002 Jul;283(1):G51-6.
18.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
19.	Region-specific adaptation of apical Na/H exchangers after extensive proximal small bowel resection.	Musch MW, etal., Am J Physiol Gastrointest Liver Physiol 2002 Oct;283(4):G975-85.
20.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.	ER function in the adult male rat: short- and long-term effects of the antiestrogen ICI 182,780 on the testis and efferent ductules, without changes in testosterone.	Oliveira CA, etal., Endocrinology 2002 Jun;143(6):2399-409.
22.	Molecular cloning of putative members of the Na/H exchanger gene family. cDNA cloning, deduced amino acid sequence, and mRNA tissue expression of the rat Na/H exchanger NHE-1 and two structurally related proteins.	Orlowski J, etal., J Biol Chem 1992 May 5;267(13):9331-9.
23.	Dopamine D3 receptor-mediated inhibition of Na+/H+ exchanger activity in normotensive and spontaneously hypertensive rat proximal tubular epithelial cells.	Pedrosa R, etal., Br J Pharmacol. 2004 Aug;142(8):1343-53. Epub 2004 Jul 20.
24.	Phospho-NHE3 forms membrane patches and interacts with beta-actin to sense and maintain constant direction during cell migration.	Perike S, etal., Exp Cell Res. 2014 May 15;324(1):13-29. doi: 10.1016/j.yexcr.2014.03.005. Epub 2014 Mar 19.
25.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
26.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
27.	GOA pipeline	RGD automated data pipeline
28.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Rosiglitazone regulates ENaC and Na-K-2Cl cotransporter (NKCC2) abundance in the obese Zucker rat.	Riazi S, etal., Am J Nephrol. 2006;26(3):245-57. Epub 2006 Jun 2.
31.	Circadian clock genes directly regulate expression of the Na(+)/H(+) exchanger NHE3 in the kidney.	Saifur Rohman M, etal., Kidney Int. 2005 Apr;67(4):1410-9.
32.	Intestinal inhibition of the Na+/H+ exchanger 3 prevents cardiorenal damage in rats and inhibits Na+ uptake in humans.	Spencer AG, etal., Sci Transl Med. 2014 Mar 12;6(227):227ra36. doi: 10.1126/scitranslmed.3007790.
33.	Role of c-SRC and ERK in acid-induced activation of NHE3.	Tsuganezawa H, etal., Kidney Int 2002 Jul;62(1):41-50.
34.	Peroxisome proliferator-activated receptor-gamma agonists induce neuroprotection following transient focal ischemia in normotensive, normoglycemic as well as hypertensive and type-2 diabetic rodents.	Tureyen K, etal., J Neurochem. 2007 Apr;101(1):41-56.
35.	Inhibition of central Na(+)/H(+) exchanger type 3 can alleviate sleep apnea in Sprague-Dawley rats.	Wang Q, etal., Chin Med J (Engl). 2014;127(1):48-53.
36.	Role of NHE isoforms in mediating bicarbonate reabsorption along the nephron.	Wang T, etal., Am J Physiol Renal Physiol 2001 Dec;281(6):F1117-22.
37.	Acute hypertension provokes internalization of proximal tubule NHE3 without inhibition of transport activity.	Yang L, etal., Am J Physiol Renal Physiol 2002 Apr;282(4):F730-40.

Additional References at PubMed

PMID:8631855	PMID:9933588	PMID:10666043	PMID:11934693	PMID:11954662	PMID:12169661	PMID:12191963	PMID:12427137	PMID:12464626	PMID:12470201	PMID:12657563	PMID:12684793
PMID:12837683	PMID:15086471	PMID:15113742	PMID:16141316	PMID:16251474	PMID:16267653	PMID:16501490	PMID:16575514	PMID:16757729	PMID:17303069	PMID:17344314	PMID:17977906
PMID:18067590	PMID:18077600	PMID:18177483	PMID:18256274	PMID:18325982	PMID:18417539	PMID:18420826	PMID:18508879	PMID:19056867	PMID:19064501	PMID:19158399	PMID:19194547
PMID:19202345	PMID:19338654	PMID:19710385	PMID:19776175	PMID:19805644	PMID:19864301	PMID:20015946	PMID:20926631	PMID:21148403	PMID:21593187	PMID:21613418	PMID:21677414
PMID:21814178	PMID:23376485	PMID:23612977	PMID:23863468	PMID:24118769	PMID:24652792	PMID:24666699	PMID:24831004	PMID:25119059	PMID:25298526	PMID:25656367	PMID:26173747
PMID:26246427	PMID:26260990	PMID:26358773	PMID:26727380	PMID:28126464	PMID:28490531	PMID:29537313	PMID:35076190

Genomics

Comparative Map Data

Slc9a3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	30,953,215 - 30,996,209 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	30,953,216 - 30,996,002 (-)	Ensembl				GRCr8
mRatBN7.2	1	29,124,633 - 29,167,912 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	29,124,674 - 29,167,417 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	28,926,541 - 28,969,373 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	34,926,400 - 34,969,224 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	29,127,163 - 29,169,987 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	31,731,652 - 31,777,144 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	31,734,327 - 31,777,070 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	33,159,607 - 33,201,753 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	29,930,908 - 29,973,686 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	27,776,582 - 27,819,219 (-)	NCBI		Celera
RGSC_v3.1	1	29,933,852 - 29,976,631 (-)	NCBI
Cytogenetic Map	1	p11	NCBI

SLC9A3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	470,456 - 524,449 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	470,456 - 524,449 (-)	Ensembl			hg38	GRCh38
GRCh37	5	470,571 - 524,564 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	526,425 - 577,447 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	526,424 - 577,447	NCBI
Celera	5	570,966 - 620,781 (-)	NCBI		Celera
Cytogenetic Map	5	p15.33	NCBI
HuRef	5	460,638 - 510,183 (-)	NCBI		HuRef
CHM1_1	5	472,597 - 524,559 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	465,265 - 518,871 (-)	NCBI		T2T-CHM13v2.0

Slc9a3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	74,234,374 - 74,317,561 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	74,269,576 - 74,317,561 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	74,086,255 - 74,169,442 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	74,121,457 - 74,169,442 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	74,258,963 - 74,303,512 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	74,587,517 - 74,632,066 (+)	NCBI		MGSCv36	mm8
Celera	13	76,451,103 - 76,495,653 (+)	NCBI		Celera
Cytogenetic Map	13	C1	NCBI
cM Map	13	40.15	NCBI

Slc9a3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955504	228,049 - 260,650 (-)	Ensembl
ChiLan1.0	NW_004955504	226,192 - 260,632 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100988373
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	112,257,212 - 112,299,973 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	112,258,794 - 112,305,293 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	444,720 - 500,121 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	597,897 - 646,108 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	597,897 - 647,464 (-)	Ensembl			panPan2	panpan1.1

SLC9A3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	11,748,556 - 11,785,209 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	11,748,175 - 11,785,786 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	16,258,013 - 16,298,999 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	11,649,118 - 11,689,897 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	11,649,113 - 11,690,798 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	11,699,849 - 11,740,579 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	11,680,359 - 11,721,422 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	11,890,462 - 11,930,512 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slc9a3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	244,802,254 - 244,839,418 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936815	963,715 - 999,280 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936815	963,715 - 999,280 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC9A3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	79,666,825 - 79,700,658 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	79,625,555 - 79,704,084 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SLC9A3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	362,417 - 408,113 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	365,135 - 408,033 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666064	27,500,607 - 27,511,358 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc9a3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	256,305 - 291,178 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624751	254,373 - 290,218 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc9a3
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	363
Count of miRNA genes:	206
Interacting mature miRNAs:	252
Transcripts:	ENSRNOT00000020711
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	5293229	34184556	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	29409279	74409279	Rat
70179	Xhs2	X-ray hypersensitivity QTL 2	3.2		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	1	1	43965634	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	5293229	34184556	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	1	34184556	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	5293229	34184556	Rat

Markers in Region

RH94714

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	29,125,783 - 29,125,983 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	31,735,437 - 31,735,636	NCBI	Rnor6.0
Rnor_5.0	1	33,160,717 - 33,160,916	UniSTS	Rnor5.0
RGSC_v3.4	1	29,932,018 - 29,932,217	UniSTS	RGSC3.4
Celera	1	27,777,692 - 27,777,891	UniSTS
Cytogenetic Map	1	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	45	108	57	55	25	38	25	6	235	109	4	92	77	64	30	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001414040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_012654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M85300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U49386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020711 ⟹ ENSRNOP00000020711

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	30,953,216 - 30,996,002 (-)	Ensembl
mRatBN7.2 Ensembl	1	29,124,674 - 29,167,417 (-)	Ensembl
Rnor_6.0 Ensembl	1	31,734,327 - 31,777,070 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094251 ⟹ ENSRNOP00000083053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	30,953,216 - 30,996,002 (-)	Ensembl
mRatBN7.2 Ensembl	1	29,126,899 - 29,167,417 (-)	Ensembl

RefSeq Acc Id:

NM_001414040 ⟹ NP_001400969

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	30,953,216 - 30,996,002 (-)	NCBI
mRatBN7.2	1	29,124,641 - 29,167,427 (-)	NCBI

RefSeq Acc Id:

NM_012654 ⟹ NP_036786

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	30,953,216 - 30,996,002 (-)	NCBI
mRatBN7.2	1	29,124,641 - 29,167,427 (-)	NCBI
Rnor_6.0	1	31,734,327 - 31,777,070 (-)	NCBI
Rnor_5.0	1	33,159,607 - 33,201,753 (-)	NCBI
RGSC_v3.4	1	29,930,908 - 29,973,686 (-)	RGD
Celera	1	27,776,582 - 27,819,219 (-)	RGD

Sequence:

show sequence

CCAGCTCCGGGATAGCGCAGAGGGCTGTGACGAAGAGCGCACGAGGTACCACGGTATGCGTGTC
GGCTCCTGGAGCTGAGCAGCAGCGATGTGGCACCCGGCTCTGGGACCAGGGTGGAAGCCGCTGC
TGGCGCTGGCCGTGGCCGTGACCAGCCTGCGAGGCGTGAGGGGCATTGAGGAGGAACCGAACAG
TGGTGGGAGCTTCCAGATAGTCACCTTCAAATGGCACCACGTCCAGGATCCATACATCATCGCA
CTCTGGATCCTCGTGGCCAGCTTGGCCAAAATCGTCTTCCATCTGTCCCACAAGGTCACCAGTG
TTGTCCCGGAGAGTGCTCTGCTCATCGTTCTGGGCCTGGTGCTGGGCGGCATCGTCTGGGCAGC
TGACCACATCGCCTCCTTCACACTCACACCCACACTCTTCTTCTTCTACCTGCTGCCCCCTATT
GTGTTGGATGCTGGGTACTTCATGCCCAATCGACTCTTCTTTGGCAACCTGGGCACCATCCTGC
TATATGCTGTCATTGGCACTATATGGAACGCAGCTACCACAGGATTGTCCCTCTATGGTGTCTT
CCTCAGTGGCCTGATGGGCGAACTGAAGATCGGCCTCCTGGATTTCCTGCTATTTGGCAGCCTC
ATTGCAGCTGTGGACCCGGTGGCTGTGCTGGCTGTGTTTGAGGAAGTCCATGTCAATGAAGTCC
TGTTCATCATTGTTTTTGGGGAGTCACTGCTTAATGACGCGGTGACTGTGGTCTTGTACAATGT
GTTTGAGTCTTTCGTGACGCTGGGTGGTGATGCAGTGACTGGCGTGGACTGTGTGAAAGGCATA
GTGTCCTTCTTCGTGGTGAGCCTGGGGGGCACTCTGGTGGGTGTCATCTTCGCCTTCCTGCTGT
CCTTGGTGACTCGTTTCACCAAGCATGTGCGTATCATCGAGCCTGGCTTCGTCTTTGTCATTTC
CTACCTGTCCTATCTGACCTCCGAGATGCTGTCCTTGTCAGCCATCCTGGCCATCACCTTTTGT
GGCATCTGCTGTCAGAAGTACGTGAAGGCCAACATCTCAGAGCAGTCGGCCACCACCGTGCGCT
ACACTATGAAGATGCTGGCAAGTGGAGCAGAGACCATTATCTTCATGTTCCTGGGCATCTCGGC
TGTGGACCCCGTCATCTGGACATGGAACACAGCTTTTGTGTTGCTGACACTGGTCTTCATTTCT
GTATACCGAGCCATTGGTGTTGTTCTGCAGACCTGGATCCTGAATCGCTACCGCATGGTGCAGC
TAGAGACCATTGACCAGGTGGTCATGTCCTACGGTGGCCTGCGTGGGGCAGTGGCCTATGCCTT
GGTGGTACTTCTGGATGAGAAAAAAGTCAAGGAGAAAAACCTGTTTGTCAGCACCACTCTCATT
GTGGTCTTCTTCACAGTCATCTTTCAGGGCCTGACCATTAAGCCCCTGGTGCAGTGGCTGAAGG
TGAAGAGGAGCGAGCAGCGTGAGCCGAAGCTCAACGAGAAGCTGCATGGCCGGGCTTTCGACCA
CATCCTCTCAGCCATTGAGGACATCTCAGGACAAATTGGACACAATTACCTCAGAGATAAGTGG
TCCAATTTTGATAGGAAGTTCCTCAGCAAAGTCCTCATGAGAAGATCTGCTCAAAAATCTCGAG
ATCGGATCCTGAATGTTTTCCATGAGCTGAATTTGAAGGATGCCATTAGCTATGTGGCCGAGGG
AGAGCGCCGTGGGTCCCTGGCCTTCATTCGCTCCCCAAGTACGGACAATATGGTCAATGTGGAC
TTCAGCACACCCCGCCCATCTACAGTGGAGGCATCCGTCTCCTATTTCTTGAGGGAAAATGTCA
GTGCTGTATGCCTGGACATGCAGTCCTTGGAACAGAGGCGGAGGAGCATCCGTGACACCGAGGA
CATGGTCACCCACCACACGTTGCAGCAGTACCTCTACAAGCCTCGGCAGGAGTACAAGCATCTC
TACAGTCGGCACGAGCTCACACCCAATGAGGATGAGAAGCAGGACAAGGAGATCTTCCACAGGA
CCATGCGGAAGCGCCTGGAGTCCTTTAAGTCGGCTAAGCTGGGCATCAACCAGAACAAGAAGGC
AGCCAAGCTATATAAGAGGGAGCGCGCACAGAAGCGGAGGAATAGCAGCATTCCTAATGGGAAG
CTGCCTATGGAGAATCTGGCACACAACTTCACCATCAAGGAGAAAGATTTGGAACTTTCAGAGC
CTGAGGAGGCCACCAACTATGAAGAGATCAGTGGAGGCATTGAATTTCTGGCCAGCGTCACCAA
AGATGTAGCCTCTGACTCTGGGGCAGGAATTGATAATCCTGTGTTCTCCCCTGACGAGGATCTG
GACCCAAGCATCCTATCCAGGGTGCCACCCTGGCTGTCCCCTGGGGAGACTGTGGTGCCCTCCC
AGAGGGCCCGTGTCCAGATTCCCAACTCTCCCAGCAACTTCCGCCGCCTGACTCCATTCCGCCT
CAGCAACAAATCAGTGGATTCCTTCCTGCAGGCTGATGGCCCCGAGGAACAGCTCCAACCCGCT
TCCCCTGAGTCCACACACATGTGATACAGGCTCTGGCACACCACTTACTGGACGCTTGTCTCGT
CAGTCATCTGCTGCTGCCCAGCACGCATTGCTCCCTGCAGGGCTTGCCCACCCACGTGCCCCAA
GCCCCGCCCCACCTGAGCGCACTTCGACTGTCACTTTTGCCTCTGGTGTTCCTGGGACAGAGCC
AGAGCACCGGGCCCCACCCAGTGCCCACGCTCGGTCGGCGGCTGCGCGCCGGGTACACAGTAGG
CGCTCATTCCAAAAGCCTCGCCCACGCCGACGCCCAGCTCTGCTAAAACTCGCTTCTCTTCCGG
GCTCTACAGAACTGCCACTGCACGCTCTGGAGCAAGAAGAGACGCCGCTGTGATCGCTGCCTGG
CCGATGGCCCAGCTCCGAGGGTCTCCCTCAGTGGCCCCTCCCCAACCAGCTAGTGTTCTTAGGG
TCCAACGCACCCTAGGAGTTTTAATGCATAGCCTAGCCCTAGGAAGAATCTTTTAATCCATATG
GTGTCCTCAGGATACCACATTGCCACCTGCCGTCTTCTTGCCCTGGTTCAGTTCCTAGGGCTCT
GTGGTGCTGCCTCCCCACCCCTACCCAGAGGCGAGCCCTTGTTAGTGTTTGCCACCCTTATTCT
GAGAGGAGAAAGATCCATGAGAGGCCTGTAGCGGACTTAATCACTGCTGGTACAAACAAAGGTC
TCAAAAATTGAGATTTGTAGAAGTGGCACCACCCAAATCAACCTCATTCTAAATAGGCAGCAGT
TTTTTGTGCGTCCCCAGAATATACACCCCTGTGGCCCTATCTGACCCCTTCCAAGTTAGTTCTC
CAGACTGCCCTATCACCTTATGATCAACTGCAGAAATATTTGGCTCTTCTAGCTCAGACTTTCC
TGTCCAGCCCCTTCCAGCCTGGGCCTTGCCGTCAAAAACAAGGTGTCCGGCCTGAACTATCCCT
AAGTTGGGAACACTGCAGATGGCCAGGCAAGCTGGGCTAGGGGCTAGAAGTGGCCCACTGGAAG
CCTTCCTTGGTCAAAATTATAGCCAGCTCTGGCATCTATCAAAGGAGGGCTCTACATCACCCAG
GAGTAGAGGAATGCAGGAATCCAGTCTCTGAACATTTTGTCCTGTCCCTAGGTCTTCAGGGCCT
CCGCCTTAGAACATTGGCCCTCTGGAGGGTAAGAGGCTGGGCCCTCAGCCCTTATCAACTTCCT
CAGAAGTCCAGTGTTCAAGAGTCACCTGAGTTTTGCTTCCAACTCACTAGAAACTTTGCCTGCA
CCACAGGGAGATCGAGATGGGGCTAAAGGTGGACTTAATGACTTCCTGGAGACTTCTGAAACAA
AGCACTCAGGTCTCTGCTCAGGAAACTAAATACTGTGTCTCAGGAACAAGGTTGACAGTTACCT
TCAGAGGAGTCACAGGAAAGTCTGTCAATCTGTATTAATGCTGCAGTTGATTTGTAGACAGGAA
GAGAGCTGGGAGGAGTGAAAGCAAAGCAAGTCCGCCCAACATACTGCATCTGCTTCAGAGTGTC
GCCCCCCCCCCCAACTGAGCCTGCCAGTATGCTGTTGACTGTCTAGTTCACACTCAGCCATCAG
ATGCTCAGCATCTGGTTTCCACAGCCCTTGAAGCATTTGTCCCTTTCCGAATTGAAGTCCAGCC
ACTGACAATGCCAGGGTCAGTAATTTCACCAGACTATTTGGAGCTGCCATTTGGGGTACTTCCA
AGGCAGGCTGTGCTTGGCTACTGTACCCGGGGTGTTCTGAGAGGCATCTATCAGCCTCTGCTCT
GCAGACAAGTTTCTCAGACCTTTCTGTGCCAGGACACTGCCTTAACACCTCATCCAATCTGCTG
GACATGGGGTCCAATTCCCACTGCAGAATTAGAAGCCAAGTGTGACGAGACAGTGCCTCAGCAA
CTGTCACCTTGCTCCAGATACCCAGAGATACCAAAGCTAGCAGCCGGGGGTGATCAATCTGTGG
AACCCTTTGACACTCTGTCCATGTTTTAGCTGTGCACAGGCCATGTCCTTTGAGTGTGTGAACT
ACACCACTGGGCATAGCCATATGGAACAGTCTTGACAAGAAAGCCTCATTCACAAAACCCCACT
TCCTGTACCTAAATGATACATACAGTGGCTACATTTCATAGTTGAGGACCCTCTTGTTCTTGTC
ATTGTTGTACAATAGAATGTAAAATCCTATGAATGTATTTCCTTAGGAAAACTATTGTAAAAGT
TTTTTTTTTATTAGGAGAGAATTTCTATTTATTTAATACTGAACTTTGACCTACTTTGTGGTAC
TACAAAGTATACAAATTTAGGAAATTTGTATTTCCGCTTCTGTATTTTCTTGAAAATAATTTTA
TTACAGTGTTCAATATACTATGTATTAATAATCTTTTTATGAAAGGAAATTTAAAGAACTCATC
AAAACCAGAAATATATTTTGAGTGGTTAAAATTGTGTATTAATGTTGTGAACATAATCATAGTT
GAACTTTAATTCTGATCTCAGAATAATGTGCCTTAAAATGCCCCCATGTGTTGGGCAGCATCTG
TACAAGGAGTCCATTAGCAAAGCTGCAGTGACT

hide sequence

RefSeq Acc Id:

XM_039100846 ⟹ XP_038956774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	30,953,215 - 30,996,209 (-)	NCBI
mRatBN7.2	1	29,124,633 - 29,167,912 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001400969	(Get FASTA)	NCBI Sequence Viewer
	NP_036786	(Get FASTA)	NCBI Sequence Viewer
	XP_038956774	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41702	(Get FASTA)	NCBI Sequence Viewer
	AAB06704	(Get FASTA)	NCBI Sequence Viewer
	EDL87676	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020711
	ENSRNOP00000020711.2
	ENSRNOP00000083053
	ENSRNOP00055003770
	ENSRNOP00060035640
	ENSRNOP00065025972
GenBank Protein	P26433	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036786 ⟸ NM_012654
- Peptide Label:	precursor
- UniProtKB:	P26433 (UniProtKB/Swiss-Prot), G3V7Y7 (UniProtKB/TrEMBL), A6JUV3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWHPALGPGWKPLLALAVAVTSLRGVRGIEEEPNSGGSFQIVTFKWHHVQDPYIIALWILVASL AKIVFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFM PNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMGELKIGLLDFLLFGSLIAAVDPVA VLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSL GGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSAILAITFCGICCQKYV KANISEQSATTVRYTMKMLASGAETIIFMFLGISAVDPVIWTWNTAFVLLTLVFISVYRAIGVV LQTWILNRYRMVQLETIDQVVMSYGGLRGAVAYALVVLLDEKKVKEKNLFVSTTLIVVFFTVIF QGLTIKPLVQWLKVKRSEQREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFL SKVLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIRSPSTDNMVNVDFSTPRPST VEASVSYFLRENVSAVCLDMQSLEQRRRSIRDTEDMVTHHTLQQYLYKPRQEYKHLYSRHELTP NEDEKQDKEIFHRTMRKRLESFKSAKLGINQNKKAAKLYKRERAQKRRNSSIPNGKLPMENLAH NFTIKEKDLELSEPEEATNYEEISGGIEFLASVTKDVASDSGAGIDNPVFSPDEDLDPSILSRV PPWLSPGETVVPSQRARVQIPNSPSNFRRLTPFRLSNKSVDSFLQADGPEEQLQPASPESTHM hide sequence

Ensembl Acc Id:

ENSRNOP00000020711 ⟸ ENSRNOT00000020711

RefSeq Acc Id:	XP_038956774 ⟸ XM_039100846
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZZ59 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083053 ⟸ ENSRNOT00000094251

RefSeq Acc Id:	NP_001400969 ⟸ NM_001414040
- Peptide Label:	precursor
- UniProtKB:	P26433 (UniProtKB/Swiss-Prot), G3V7Y7 (UniProtKB/TrEMBL), A6JUV3 (UniProtKB/TrEMBL)

Protein Domains

Cation/H+ exchanger transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P26433-F1-model_v2	AlphaFold	P26433	1-831	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689560

Promoter ID:

EPDNEW_R83

Type:

initiation region

Name:

Slc9a3_1

Description:

solute carrier family 9 member A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	31,777,078 - 31,777,138	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3720	AgrOrtholog
BioCyc Gene	G2FUF-61939	BioCyc
Ensembl Genes	ENSRNOG00000015159	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055003268	UniProtKB/Swiss-Prot
	ENSRNOG00060024855	UniProtKB/Swiss-Prot
	ENSRNOG00065019340	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020711	ENTREZGENE
	ENSRNOT00000020711.4	UniProtKB/Swiss-Prot
	ENSRNOT00000094251	ENTREZGENE
	ENSRNOT00055005073	UniProtKB/Swiss-Prot
	ENSRNOT00060043066	UniProtKB/Swiss-Prot
	ENSRNOT00065032543	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.140.1330	UniProtKB/Swiss-Prot
InterPro	Cation/H_exchanger	UniProtKB/Swiss-Prot
	Cation/H_exchanger_CPA1	UniProtKB/Swiss-Prot
	Na/H_exchanger_3/5	UniProtKB/Swiss-Prot
	NaH_exchanger	UniProtKB/Swiss-Prot
KEGG Report	rno:24784	UniProtKB/Swiss-Prot
NCBI Gene	24784	ENTREZGENE
PANTHER	PTHR10110	UniProtKB/Swiss-Prot
	SODIUM/HYDROGEN EXCHANGER 3	UniProtKB/Swiss-Prot
Pfam	Na_H_Exchanger	UniProtKB/Swiss-Prot
PhenoGen	Slc9a3	PhenoGen
PRINTS	NAHEXCHNGR	UniProtKB/Swiss-Prot
	NAHEXCHNGR3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015159	RatGTEx
	ENSRNOG00055003268	RatGTEx
	ENSRNOG00060024855	RatGTEx
	ENSRNOG00065019340	RatGTEx
UniProt	A0A8I5ZZ59	ENTREZGENE, UniProtKB/TrEMBL
	A6JUV3	ENTREZGENE, UniProtKB/TrEMBL
	G3V7Y7	ENTREZGENE, UniProtKB/TrEMBL
	P26433	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Slc9a3	solute carrier family 9 member A3	Slc9a3	solute carrier family 9 member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-24	Slc9a3	solute carrier family 9 member 3	Slc9a3	solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Slc9a3	solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3	Slc9a3	solute carrier family 9 (sodium/hydrogen exchanger), member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Slc9a3	solute carrier family 9 (sodium/hydrogen exchanger), member 3		solute carrier family 9, member 3	Name updated	1299863	APPROVED
2003-04-09	Slc9a3	solute carrier family 9, member 3		Solute carrier family 9 (sodium/hydrogen exchanger 3), antiporter 3, Na+/H+ (amiloride insensitive)	Name updated	629478	APPROVED
2002-06-10	Slc9a3	Solute carrier family 9 (sodium/hydrogen exchanger 3), antiporter 3, Na+/H+ (amiloride insensitive)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	associated with chronic metabolic acidosis	628393
gene_disease	decreased localization to the renal proximal tubule apical brush border is associated with a model of acute hypertension	737665
gene_drugs	administration of the antiestrogen ICI 182,780 decreases the levels of mRNA and protein	628393
gene_drugs	selective inhibitor S3226 blocks activity and growth response in young uninephrectomized rats	628393
gene_expression	expressed in the proximal tubule of the kidney	628393
gene_expression	expressed in the small and large intestine	628393
gene_process	facilitates increased absorption of NaCl in the intestine	625757
gene_process	facilitates the hyperplastic/hypertrophic response in different cell types	628529
gene_process	mediates fluid and electrolyte reabsorption in the efferent ductules	628393
gene_regulation	estrogen receptor (ER) is required for the expression and function	628393
gene_regulation	activity is regulated by physiological stimuli, glucorticoids, aldosterone, and other neurohormones and also by signal transduction pathways that involve protein kinase C, cAMP, cGMP, intracellular calcium and accessory proteins such as NHE regulatory fac	628393
gene_regulation	increased acidosis reported in rats after 6 days of treatment with ammonium chloride resulted in enhanced exchanger activity	628393
gene_regulation	significant increase in the mRNA is observed in the uninephrectomized rats	628393
gene_regulation	after the removal of the renal mass the activity of the apical membrane exchanger is increased	628393

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)