Advanced Search (OLGA)

Gene: Exoc6 (exocyst complex component 6) Rattus norvegicus

Analyze

Symbol:

Exoc6

Name:

exocyst complex component 6

RGD ID:

3653

Description:

Predicted to be involved in Golgi to plasma membrane transport and exocytosis. Predicted to act upstream of or within erythrocyte differentiation. Predicted to be located in several cellular components, including Flemming body; growth cone; and perinuclear region of cytoplasm. Predicted to be part of exocyst. Orthologous to human EXOC6 (exocyst complex component 6); PARTICIPATES IN insulin signaling pathway; INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; arsenite(3-).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

exocyst complex component Sec15A; rSec15; Sec15; SEC15 homolog (S. cerevisiae); SEC15-like 1; SEC15-like 1 (S. cerevisiae); SEC15-like protein 1; Sec15l1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EXOC6 (exocyst complex component 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Exoc6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Exoc6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EXOC6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EXOC6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Exoc6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EXOC6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EXOC6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Exoc6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Exoc6 (exocyst complex component 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	EXOC6B (exocyst complex component 6B)	HGNC	OrthoDB
Homo sapiens (human):	PHOSPHO1 (phosphoethanolamine/phosphocholine phosphatase 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EXOC6 (exocyst complex component 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Exoc6 (exocyst complex component 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	exoc6 (exocyst complex component 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC15	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Sec15	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sec-15	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	exoc6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	exoc6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	244,727,084 - 244,870,263 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	244,711,981 - 244,870,396 (+)	Ensembl				GRCr8
mRatBN7.2	1	235,314,612 - 235,457,824 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	235,300,369 - 235,457,015 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	243,699,707 - 243,842,113 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	250,631,902 - 250,774,276 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	243,470,086 - 243,612,479 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	256,211,879 - 256,369,318 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	256,226,179 - 256,368,813 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	263,708,969 - 263,850,916 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	241,964,047 - 242,008,416 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	232,405,767 - 232,549,626 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Di-n-octyl phthalate (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

iron atom (ISO)

iron(0) (ISO)

lead(0) (ISO)

lithium atom (ISO)

lithium hydride (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

melphalan (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

nickel sulfate (ISO)

nitrates (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

potassium chromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (ISO)

thapsigargin (EXP)

thimerosal (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

erythrocyte differentiation (ISO)

exocytosis (IBA,IEA)

Golgi to plasma membrane transport (IBA)

intracellular protein transport (IEA)

protein transport (IEA)

vesicle tethering involved in exocytosis (IEA)

Cellular Component

cytoplasm (IEA)

exocyst (IBA,IEA)

Flemming body (IEA)

growth cone (IEA)

perinuclear region of cytoplasm (IEA)

plasma membrane (IEA)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Subunit structure of the mammalian exocyst complex.	Kee Y, etal., Proc Natl Acad Sci U S A 1997 Dec 23;94(26):14438-43.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:3960859

Genomics

Comparative Map Data

Exoc6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	244,727,084 - 244,870,263 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	244,711,981 - 244,870,396 (+)	Ensembl				GRCr8
mRatBN7.2	1	235,314,612 - 235,457,824 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	235,300,369 - 235,457,015 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	243,699,707 - 243,842,113 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	250,631,902 - 250,774,276 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	243,470,086 - 243,612,479 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	256,211,879 - 256,369,318 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	256,226,179 - 256,368,813 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	263,708,969 - 263,850,916 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	241,964,047 - 242,008,416 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	232,405,767 - 232,549,626 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

EXOC6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	92,826,831 - 93,059,490 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	92,826,831 - 93,059,493 (+)	Ensembl			hg38	GRCh38
GRCh37	10	94,586,588 - 94,819,247 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	94,584,450 - 94,809,241 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	94,598,248 - 94,809,240	NCBI
Celera	10	88,335,925 - 88,560,454 (+)	NCBI		Celera
Cytogenetic Map	10	q23.33	NCBI
HuRef	10	88,221,556 - 88,446,771 (+)	NCBI		HuRef
CHM1_1	10	94,877,294 - 95,101,961 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	93,706,495 - 93,939,384 (+)	NCBI		T2T-CHM13v2.0

Exoc6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	37,525,181 - 37,672,499 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	37,509,327 - 37,672,507 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	37,536,763 - 37,684,052 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	37,520,879 - 37,684,059 (+)	Ensembl			mm10	GRCm38
MGSCv37	19	37,624,908 - 37,757,743 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	37,615,562 - 37,748,397 (+)	NCBI		MGSCv36	mm8
Celera	19	38,347,853 - 38,470,250 (+)	NCBI		Celera
Cytogenetic Map	19	C2	NCBI
cM Map	19	32.32	NCBI

Exoc6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	389,940 - 601,304 (-)	Ensembl
ChiLan1.0	NW_004955425	389,940 - 560,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

EXOC6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	104,837,864 - 105,095,441 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	104,843,171 - 105,100,759 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	89,569,961 - 89,803,658 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	93,060,721 - 93,316,030 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	93,088,914 - 93,316,030 (+)	Ensembl			panPan2	panpan1.1

EXOC6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	7,190,918 - 7,414,367 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	7,207,194 - 7,414,362 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	7,383,691 - 7,590,914 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	7,450,430 - 7,674,414 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	7,443,006 - 7,674,405 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	7,187,448 - 7,394,618 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	7,222,047 - 7,431,904 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	7,386,421 - 7,593,646 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Exoc6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	40,201,688 - 40,392,331 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936601	1,831,165 - 1,975,872 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936601	1,835,469 - 1,976,735 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EXOC6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	104,326,827 - 104,549,636 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	104,326,943 - 104,549,638 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

EXOC6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	85,967,316 - 86,310,052 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	86,097,257 - 86,310,049 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	46,864,128 - 47,077,094 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Exoc6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	4,055,685 - 4,310,478 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	4,043,672 - 4,311,147 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Exoc6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	36,077,804 - 36,222,944 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Exoc6
760 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	37
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000054748
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	223964326	248681945	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	205674651	250674651	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	238398865	255849249	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	203675682	248675682	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	205674651	250674651	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

D1Got347

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	235,417,720 - 235,417,880 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	256,329,231 - 256,329,390	NCBI	Rnor6.0
Rnor_5.0	1	263,811,655 - 263,811,814	UniSTS	Rnor5.0
RGSC_v3.4	1	242,003,148 - 242,003,307	UniSTS	RGSC3.4
Celera	1	232,510,311 - 232,510,470	UniSTS
Cytogenetic Map	1	q54	UniSTS

AU049881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	235,402,509 - 235,402,691 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	256,314,020 - 256,314,201	NCBI	Rnor6.0
Rnor_5.0	1	263,796,785 - 263,796,966	UniSTS	Rnor5.0
Celera	1	232,495,101 - 232,495,282	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC126293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000054748 ⟹ ENSRNOP00000051630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	244,725,038 - 244,869,473 (+)	Ensembl
mRatBN7.2 Ensembl	1	235,314,615 - 235,457,015 (+)	Ensembl
Rnor_6.0 Ensembl	1	256,226,179 - 256,368,813 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094089 ⟹ ENSRNOP00000076565

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	244,723,478 - 244,869,473 (+)	Ensembl
mRatBN7.2 Ensembl	1	235,300,369 - 235,457,015 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115437 ⟹ ENSRNOP00000092314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	244,727,080 - 244,870,396 (+)	Ensembl
mRatBN7.2 Ensembl	1	235,314,598 - 235,426,472 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165394 ⟹ ENSRNOP00000107166

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	244,711,981 - 244,870,396 (+)	Ensembl

RefSeq Acc Id:

NM_019277 ⟹ NP_062150

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	244,727,084 - 244,869,453 (+)	NCBI
mRatBN7.2	1	235,314,612 - 235,456,998 (+)	NCBI
Rnor_6.0	1	256,226,184 - 256,368,492 (+)	NCBI
Rnor_5.0	1	263,708,969 - 263,850,916 (+)	NCBI
RGSC_v3.4	1	241,964,047 - 242,008,416 (-)	RGD
Celera	1	232,405,767 - 232,549,626 (+)	RGD

Sequence:

show sequence

GGCGCCGCGCCCGGCCGGCGCCTCCGCTTCCAGCCAAGATGGCGGAGAGCGGCGAGGCTCTGGG
TACGGTCCCGGAGCACGAGCGGATCTTGCAGGAGATCGAAAGCACGGACACCGCCTGCGTAGGG
CCCACCCTTCGGTCTGTGTATGATGGTCAGCCAAATGCACACAAGAAGTTCATGGAAAAGCTAG
ATGCCTGCATCCGCAACCATGACAAGGAGATTGAGAAAATGTGTAACTTCCATCACCAGGGCTT
TGTAGATGCTATCACAGAGCTCCTCAAAGTAAGGGCGGACGCAGAAAAGCTGAAGGTCCAGGTT
ACTGATACCAACCGAAGGTTCCAAGATGCTGGAAAAGAGGTGATAGAACAAACAGAAGATATTA
TTCGGTGTAGAATTCAGCAGAGAAATATTACAACCGTAGTAGAGAAATTGCAGTTATGCCTGCC
AGTGTTGGAGATGTACAGTAAACTGAAGGAACAGATGAGCATGCAGAGGTATTATTCTGCACTT
AAAACAATGGAACAGTTAGAGAACGTATACTTTCCTCGGGTTAGCCAGTACCGCTTCTGTCAGC
TCATGATGGACACACTTCCTAAACTCCGGGAGGATATCAAAGACATCTCCATGTCTGACCTCAA
GGACTTTCTGGAAAGCATTCGAAAGCATTCTGACAAAATAGGGGAAACAGCCATGAAACAGGCA
CAACAGCAGAAGAGCTTCAGTATTGCTGTACAGAAGCAAACCAATATGAGGTTTGGGAAAAATA
TGCATGTAAACAATGACAGGACTCTAGAGGAAAAGAGTGACATCATACTGAAGCACACACTTGA
GGAGGAGGCCGAGAATGACGAGGAGGTCTTAACTGTTCAAGATCTCGTTGACTTTTCCCCTGTT
TACCGATGCTCACACATTTATTCTGCTTTGGGTGATGAAGAAACATTTGAAAATTATTACCGGA
AGCAAAGGAAGAAGCAGGCGCGCCTGGTTCTGCAGCCGCAGTCGAGTGTGCATGAAACAGTTGA
TGGCTATAGAAGATATTTCACTCAGATTGTAGGGTTCTTTGTTGTGGAAGATCACATTTTACAT
GTGACCCAAGGATTAGTAACCAGGGCATACACTGATGAACTCTGGAACATGGCCCTCTCAAAGA
TAATTGCTGTCCTCAGAGCTCACTCATCTTACTGCACTGATCCTGACCTTGTTCTGGAGCTGAA
GAATCTCATCGTCATTTTTGCGGATACTTTGCAGGGTTATGGCTTTTCTGTCAACCGACTCTTT
GACCTTCTATTTGAAATAAGAGATCAATACAACGAAACACTGCTTAAGAAATGGGCCGGTATTT
TCAGGGACATTTTTGAAGAAGATAACTACAGCCCTATTCCTATTGGCAGTGAAGAAGAATATAA
AATGGTCATCAGTAAATTCCCCTTCCAAGATCCGGACCTTGAAAAGCAATCCTTCCCAAAGAAG
TTTCCCATGTCCCAGTCAGTGCCTCTTATTTATATTCAAGTTAAAGAATTTATTTATGCCAGTC
TTAAATTCTCAGAGTCACTACACCGAAGCTCTACAGAAATAGACGATATGCTTAGGAAGTCAAC
AAATCTGCTGCTGACCAGGATTCTGAGTAGCTGCTTACTGAACCTCATTAGAAAACCTCACATA
GGTTTGACAGAGCTGGTGCAAATTATCATAAACACAACACACCTGGAGCAGGCTTGCAAATACC
TGGAGGACTTTATAACTAACATTACAAATATTTCTCAAGAAACCGTTCACACCACAAGACTTTA
TGGACTTTCTACTTTTAAGGATGCACGACATGCAGCGGAAGGAGAAATATATACCAAACTCAAT
CAGAAGATTGATGAGTTTGTCCAGCTGGCCGACTACGACTGGACCATGGCTGAGTCGGATGGGA
GAGCAAGTGGTTATTTAATGGATCTTATTAATTTTTTGAGAAGCATCTTTCAAGTATTTACCCA
CTTGCCTGGGAAAGTTGCCCAGACAGCTTGCATGTCAGCCTGCCAACATCTGTCCACATCCTTG
ATGCAGATGCTCCTGGACAGCGAGTTAAAGCAGATCAGCATGGGGGCCGTACAGCAGTTTAACC
TAGACGTCATACAGTGCGAATTGTTTGCCAGCTCTGAGCCTGTGCCAGGATTCCAAGGGGACAC
CCTGCAGCTGGCCTTCATTGACCTCAGACAGCTCCTTGACTTGTTTATGGTTTGGGACTGGTCT
ACTTACCTGGCTGACTATGGGCAGCCAGCTTCCAAGTACCTCCGGGTGAACCCACACGCCGCCC
TTACGCTTTTGGAGAAGATGAAGGACACCAGTAAGAAGAATAACATATTTGCCCAGTTCCGGAA
GAACGACCGGGACAGACAGAAGCTGATCGAGACAGTGGTGAAACAGCTCAGAGGCTTGGTGACC
GGTATGTCCCAGCACATGTAGACCAGATCCATGCCCGAGTGCTTCTCTGTGGCCAGCACCGGTC
ATGAGACAATAATTTGTTTACAGAAGCCAAAAACTGTAGTAGAGGAAAGATACTAATGAGGGCT
TAAACAATAAGGACAGCAAACATCATTTGTATGGACTTTTAATAACTGAATACTATTTTATATA
TAAAAATGTAACATTAATTTTTTCCAATTTTAGAAGAAAAGTCAAAAGTGTAATATATAAACCC
AATAAATTGTGTATG

hide sequence

RefSeq Acc Id:

XM_039088459 ⟹ XP_038944387

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	244,757,538 - 244,870,263 (+)	NCBI
mRatBN7.2	1	235,345,068 - 235,457,824 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_062150	(Get FASTA)	NCBI Sequence Viewer
	XP_038944387	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM13202	(Get FASTA)	NCBI Sequence Viewer
	EDM13203	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000092314
GenBank Protein	O54923	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062150 ⟸ NM_019277

- UniProtKB:

O54923 (UniProtKB/Swiss-Prot), A6I171 (UniProtKB/TrEMBL), F1M0F4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAESGEALGTVPEHERILQEIESTDTACVGPTLRSVYDGQPNAHKKFMEKLDACIRNHDKEIEK
MCNFHHQGFVDAITELLKVRADAEKLKVQVTDTNRRFQDAGKEVIEQTEDIIRCRIQQRNITTV
VEKLQLCLPVLEMYSKLKEQMSMQRYYSALKTMEQLENVYFPRVSQYRFCQLMMDTLPKLREDI
KDISMSDLKDFLESIRKHSDKIGETAMKQAQQQKSFSIAVQKQTNMRFGKNMHVNNDRTLEEKS
DIILKHTLEEEAENDEEVLTVQDLVDFSPVYRCSHIYSALGDEETFENYYRKQRKKQARLVLQP
QSSVHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCT
DPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWAGIFRDIFEEDNYSPI
PIGSEEEYKMVISKFPFQDPDLEKQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTE
IDDMLRKSTNLLLTRILSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQ
ETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMAESDGRASGYLMDLINFL
RSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSE
PVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPHAALTLLEKMKDTSKK
NNIFAQFRKNDRDRQKLIETVVKQLRGLVTGMSQHM

hide sequence

Ensembl Acc Id:

ENSRNOP00000051630 ⟸ ENSRNOT00000054748

RefSeq Acc Id:	XP_038944387 ⟸ XM_039088459
- Peptide Label:	isoform X1
- UniProtKB:	A6I171 (UniProtKB/TrEMBL), F1M0F4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092314 ⟸ ENSRNOT00000115437

Ensembl Acc Id:

ENSRNOP00000076565 ⟸ ENSRNOT00000094089

Ensembl Acc Id:

ENSRNOP00000107166 ⟸ ENSRNOT00000165394

Protein Domains

Exocyst complex component EXOC6/Sec15 N-terminal Exocyst complex subunit EXOC6/Sec15 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O54923-F1-model_v2	AlphaFold	O54923	1-804	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690878

Promoter ID:

EPDNEW_R1403

Type:

initiation region

Name:

Exoc6_1

Description:

exocyst complex component 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	256,226,209 - 256,226,269	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3653	AgrOrtholog
BioCyc Gene	G2FUF-55803	BioCyc
Ensembl Genes	ENSRNOG00000036601	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000115437	ENTREZGENE
Gene3D-CATH	1.10.357.30	UniProtKB/Swiss-Prot
	1.20.58.670	UniProtKB/Swiss-Prot
InterPro	EXOC6/Sec15	UniProtKB/Swiss-Prot
	EXOC6/Sec15_C_dom1	UniProtKB/Swiss-Prot
	EXOC6/Sec15_C_dom2	UniProtKB/Swiss-Prot
	EXOC6_Sec15_N	UniProtKB/Swiss-Prot
	Sec15_C	UniProtKB/Swiss-Prot
KEGG Report	rno:50556	UniProtKB/Swiss-Prot
NCBI Gene	50556	ENTREZGENE
PANTHER	EXOCYST COMPLEX COMPONENT 6	UniProtKB/Swiss-Prot
	PTHR12702	UniProtKB/Swiss-Prot
Pfam	EXOC6_Sec15_N	UniProtKB/Swiss-Prot
	Sec15	UniProtKB/Swiss-Prot
PhenoGen	Exoc6	PhenoGen
PIRSF	Sec15	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000036601	RatGTEx
TIGR	TC218830
UniProt	A0A8I5ZJ80_RAT	UniProtKB/TrEMBL
	A0A8I6ADF6_RAT	UniProtKB/TrEMBL
	A0ABK0LNB6_RAT	UniProtKB/TrEMBL
	A6I171	ENTREZGENE, UniProtKB/TrEMBL
	A6I172_RAT	UniProtKB/TrEMBL
	EXOC6_RAT	UniProtKB/Swiss-Prot
	F1M0F4	ENTREZGENE, UniProtKB/TrEMBL
	O54923	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Exoc6	exocyst complex component 6	Sec15l1	SEC15-like 1 (S. cerevisiae)	Symbol and Name updated	1299863	APPROVED
2004-09-10	Sec15l1	SEC15-like 1 (S. cerevisiae)	Sec15	SEC15 homolog (S. cerevisiae)	Symbol and Name updated	1299863	APPROVED
2002-06-10	Sec15	SEC15 homolog (S. cerevisiae)			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_homology	shows 24% identity to the yeast homolog	69988
gene_protein	822 amino acid protein	69988

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - PID (archival)