Advanced Search (OLGA)

Gene: Pdlim4 (PDZ and LIM domain 4) Rattus norvegicus

Analyze

Symbol:

Pdlim4

Name:

PDZ and LIM domain 4

RGD ID:

3575

Description:

Enables alpha-actinin binding activity. Involved in several processes, including excitatory chemical synaptic transmission; positive regulation of stress fiber assembly; and regulation of postsynaptic membrane neurotransmitter receptor levels. Located in several cellular components, including endosome lumen; postsynaptic membrane; and stress fiber. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in osteoporosis. Orthologous to human PDLIM4 (PDZ and LIM domain 4); INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

H-Rev18; LIM protein RIL; PDZ and LIM domain protein 4; reversion induced LIM; reversion induced LIM gene; reversion-induced LIM protein; Ril; RIT-18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDLIM4 (PDZ and LIM domain 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Pdlim4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdlim4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDLIM4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDLIM4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdlim4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDLIM4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDLIM4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdlim4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pdlim4 (PDZ and LIM domain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pdlim4 (PDZ and LIM domain 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PDLIM4 (PDZ and LIM domain 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdlim4 (PDZ and LIM domain 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdlim4 (PDZ and LIM domain 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42319	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Zasp66	Alliance	DIOPT (InParanoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pdlim4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pdlim4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	38,699,444 - 38,713,696 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	38,699,444 - 38,713,659 (-)	Ensembl				GRCr8
mRatBN7.2	10	38,198,686 - 38,212,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	38,198,689 - 38,212,938 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	42,884,121 - 42,898,322 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	42,374,222 - 42,388,423 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	37,877,924 - 37,892,125 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	39,390,578 - 39,405,322 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	39,390,581 - 39,405,311 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	39,171,365 - 39,185,480 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	10	37,540,725 - 37,554,961 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Lung Neoplasms (ISO)

Neurodevelopmental Disorders (ISO)

osteoporosis (ISO)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,3,5-trinitro-1,3,5-triazinane (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

aconitine (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cytarabine (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

Evodiamine (ISO)

flavonoids (EXP)

FR900359 (ISO)

furan (EXP)

furfural (ISO)

gentamycin (EXP)

methoxychlor (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

niclosamide (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

Tributyltin oxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IBA,IDA,IEA,ISO)

excitatory chemical synaptic transmission (IDA)

heart development (IBA)

muscle structure development (IBA)

positive regulation of stress fiber assembly (IDA,IMP)

regulation of postsynaptic membrane neurotransmitter receptor levels (IDA,IMP)

Cellular Component

actin cytoskeleton (IEA,IPI,ISO)

adherens junction (IBA)

cytoplasm (IEA,ISO)

cytoskeleton (IEA,ISO)

cytosol (IEA,ISO)

dendritic spine (IDA,IEA)

early endosome lumen (IDA)

early endosome membrane (IEA)

endomembrane system (IEA)

filamentous actin (IBA,IEA,ISO)

glutamatergic synapse (IDA,IEP,IMP)

lamellipodium (IEA,ISO)

neuron projection (IEA)

nucleus (IEA,ISO)

perinuclear region of cytoplasm (IEA,ISO)

postsynaptic density (IDA,IEP)

postsynaptic membrane (IDA)

recycling endosome lumen (IDA)

recycling endosome membrane (IEA)

stress fiber (IBA,IDA,IEA,ISO)

synapse (IEA)

Z disc (IBA)

Molecular Function

actin binding (IBA)

actinin binding (IPI)

alpha-actinin binding (IEA,IPI,ISO)

cytoskeletal protein binding (IEA)

metal ion binding (IEA)

muscle alpha-actinin binding (IBA)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO)

protein phosphatase binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of ril, a novel LIM domain gene, is down-regulated in Hras-transformed cells and restored in phenotypic revertants.	Kiess M, etal., Oncogene 1995 Jan 5;10(1):61-8.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	CLP36 and RIL recruit a-actinin-1 to stress fibers and differentially regulate stress fiber dynamics in F2408 fibroblasts.	Miyazaki K, etal., Exp Cell Res. 2012 Aug 15;318(14):1716-25. doi: 10.1016/j.yexcr.2012.05.006. Epub 2012 May 30.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Actin/alpha-actinin-dependent transport of AMPA receptors in dendritic spines: role of the PDZ-LIM protein RIL.	Schulz TW, etal., J Neurosci. 2004 Sep 29;24(39):8584-94.
10.	The PDZ-LIM protein RIL modulates actin stress fiber turnover and enhances the association of alpha-actinin with F-actin.	Vallenius T, etal., Exp Cell Res 2004 Feb 1;293(1):117-28.
11.	Cloning of a rat cDNA encoding a novel LIM domain protein with high homology to rat RIL.	Wang H, etal., Gene 1995 Nov 20;165(2):267-71.

Additional References at PubMed

PMID:1300470	PMID:10826496	PMID:15663004	PMID:19307596	PMID:20120020	PMID:21636573	PMID:25158098	PMID:38968989

Genomics

Comparative Map Data

Pdlim4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	38,699,444 - 38,713,696 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	38,699,444 - 38,713,659 (-)	Ensembl				GRCr8
mRatBN7.2	10	38,198,686 - 38,212,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	38,198,689 - 38,212,938 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	42,884,121 - 42,898,322 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	42,374,222 - 42,388,423 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	37,877,924 - 37,892,125 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	39,390,578 - 39,405,322 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	39,390,581 - 39,405,311 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	39,171,365 - 39,185,480 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	10	37,540,725 - 37,554,961 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

PDLIM4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	132,257,696 - 132,273,454 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	132,257,644 - 132,273,454 (+)	Ensembl			hg38	GRCh38
GRCh37	5	131,593,389 - 131,609,147 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	131,621,286 - 131,637,046 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	131,621,285 - 131,637,046	NCBI
Celera	5	127,723,467 - 127,739,259 (+)	NCBI		Celera
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	126,785,601 - 126,801,399 (+)	NCBI		HuRef
CHM1_1	5	131,026,116 - 131,041,912 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	132,777,576 - 132,793,334 (+)	NCBI		T2T-CHM13v2.0

Pdlim4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	53,945,754 - 53,959,814 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	53,945,754 - 53,959,840 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	54,054,928 - 54,069,032 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	54,054,928 - 54,069,014 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	53,868,430 - 53,882,519 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	53,898,355 - 53,912,391 (-)	NCBI		MGSCv36	mm8
Celera	11	58,642,620 - 58,656,709 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	32.13	NCBI

Pdlim4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	3,638,264 - 3,646,600 (+)	Ensembl
ChiLan1.0	NW_004955408	3,638,264 - 3,647,792 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDLIM4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	127,575,598 - 127,591,444 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	125,715,172 - 125,731,007 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	127,680,339 - 127,696,172 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	133,843,313 - 133,857,935 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	133,843,313 - 133,857,935 (+)	Ensembl			panPan2	panpan1.1

PDLIM4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	20,570,839 - 20,587,185 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	20,570,833 - 20,585,594 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	19,372,592 - 19,387,383 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	21,356,501 - 21,371,304 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	21,355,561 - 21,372,930 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	20,075,298 - 20,090,074 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	19,923,413 - 19,938,202 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	20,565,277 - 20,580,071 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pdlim4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	115,888,263 - 115,902,441 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	2,890,510 - 2,905,203 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936647	2,891,025 - 2,905,197 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDLIM4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	134,555,666 - 134,570,348 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	134,555,367 - 134,570,356 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	139,959,492 - 139,973,907 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDLIM4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	35,087,966 - 35,102,703 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	35,088,001 - 35,105,018 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	42,841,390 - 42,856,126 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdlim4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	39,825,025 - 39,840,361 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	39,826,435 - 39,840,280 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pdlim4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	36,516,380 - 36,530,447 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pdlim4
62 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	76
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000074616
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35893263	52293000	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	29377046	52699134	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	47	59	6	311	147	11	140	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001393871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001393872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001393873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_017062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X76454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074616 ⟹ ENSRNOP00000064261

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	38,699,444 - 38,713,659 (-)	Ensembl
mRatBN7.2 Ensembl	10	38,198,689 - 38,212,938 (-)	Ensembl
Rnor_6.0 Ensembl	10	39,390,581 - 39,405,311 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101447 ⟹ ENSRNOP00000086241

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	38,699,444 - 38,713,659 (-)	Ensembl
mRatBN7.2 Ensembl	10	38,198,694 - 38,212,895 (-)	Ensembl

RefSeq Acc Id:

NM_001393871 ⟹ NP_001380800

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	38,699,444 - 38,713,659 (-)	NCBI
mRatBN7.2	10	38,198,686 - 38,212,901 (-)	NCBI

RefSeq Acc Id:

NM_001393872 ⟹ NP_001380801

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	38,699,444 - 38,713,659 (-)	NCBI
mRatBN7.2	10	38,198,686 - 38,212,901 (-)	NCBI

RefSeq Acc Id:

NM_001393873 ⟹ NP_001380802

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	38,699,444 - 38,713,659 (-)	NCBI
mRatBN7.2	10	38,198,686 - 38,212,901 (-)	NCBI

RefSeq Acc Id:

NM_017062 ⟹ NP_058758

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	38,699,444 - 38,713,659 (-)	NCBI
mRatBN7.2	10	38,198,686 - 38,212,901 (-)	NCBI
Rnor_6.0	10	39,390,581 - 39,405,311 (-)	NCBI
Rnor_5.0	10	39,171,365 - 39,185,480 (-)	NCBI
Celera	10	37,540,725 - 37,554,961 (-)	RGD

Sequence:

show sequence

AGGCGGCGGCAACGGCGGCGGCGACTCCTCCGTGTCCGCCTCCAGCTCCGGCTGCAGCTCCGGC
CCGCGATGACCCACGCGGTGACCCTGCGCGGCCCTTCACCCTGGGGCTTCCGCCTGGTGGGCGG
CCGTGACTTCAGTGCCCCCCTCACCATCTCGCGGGTTCATGCTGGGAGCAAAGCGGCCCTGGCT
GCCCTGTGCCCAGGTGACTCGATCCAAGCCATCAACGGTGAGAGCACTGAGCTCATGACACACC
TGGAGGCCCAGAACCGCATTAAAGGCTGCCACGATCACCTTACACTCTCAGTAAGCAGGCCTGA
GAACAAGAACTGGCCCAGTTCCCCTAATGACAAGGCCCAAGCGCATAGGATCCACATTGACCCT
GAGGCCCAGGATGGCAGCCCAGCCACCAGCAGGCGGTCCTCAATCTCTGGAATTAGTCTGGAGG
ACAACAGATCGGGCCTGGGATCTCCGTATGGCCAGCCACCTCGCCTTCCAGTTCCTCACAATGG
CAGCAGCAATGAGGTCACCCTGCCATCCCAGATGAGCGCTCTGCATGTGTCTCCACCCCCCAGT
GCTGACACACCCAGGATTCTCCCTCGGAACCGGGACTGCAGGGTGGACCTGGGTTCAGAGGTAT
ACAGGATGTTAAGGGAGCCAGCAGAGCCAGCAGCCTCAGAGCCCAAACAGTCTGGATCCTTCCG
CTACTTGCAAGGCATGCTAGAGGCTGGCGAAGGCGGGGATCGGCCTGGGTCTGGTGGTTCCCGG
AACCTCAAGCCAGCAGCCAGCAAGCTGGGTGCTCCACTGAGTGGCCTGCAGGGGTTACCAGAGT
GCACACGCTGTGGCCACGGGATCGTGGGAACCATCGTCAAGGCGAGGGACAAGCTCTACCATCC
CGAGTGCTTCATGTGTAGCGACTGTGGCCTGAATCTCAAGCAGCGTGGGTACTTCTTCCTAGAC
GAACGGCTGTACTGCGAGAACCATGCCAAGGCTCGAGTCAAGCCACCGGAGGGATATGACGTGG
TGGCTGTATATCCCAATGCCAAGGTGGAACTTGTCTGAGCTGGGAAATCTTGTCTTGCCTCTGC
TTCATTTAATGTCCCCCCTCCCCACCCCCGTGGCCTGTGTAAATATATGTCCTCCTGGCCTTTC
TAATAAAGTCCCTCTGCTTGTCCTCCAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085241 ⟹ XP_038941169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	38,699,444 - 38,713,696 (-)	NCBI
mRatBN7.2	10	38,198,686 - 38,212,935 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001380800	(Get FASTA)	NCBI Sequence Viewer
	NP_001380801	(Get FASTA)	NCBI Sequence Viewer
	NP_001380802	(Get FASTA)	NCBI Sequence Viewer
	NP_001416963	(Get FASTA)	NCBI Sequence Viewer
	NP_001416964	(Get FASTA)	NCBI Sequence Viewer
	NP_001416965	(Get FASTA)	NCBI Sequence Viewer
	NP_058758	(Get FASTA)	NCBI Sequence Viewer
	XP_038941169	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA53992	(Get FASTA)	NCBI Sequence Viewer
	EDM04418	(Get FASTA)	NCBI Sequence Viewer
	EDM04419	(Get FASTA)	NCBI Sequence Viewer
	EDM04420	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064261
	ENSRNOP00000086241
GenBank Protein	P36202	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058758 ⟸ NM_017062
- Peptide Label:	isoform 2
- UniProtKB:	P36202 (UniProtKB/Swiss-Prot), M0R4H5 (UniProtKB/TrEMBL), A6HEG3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTHAVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDSIQAINGESTELMTHLE AQNRIKGCHDHLTLSVSRPENKNWPSSPNDKAQAHRIHIDPEAQDGSPATSRRSSISGISLEDN RSGLGSPYGQPPRLPVPHNGSSNEVTLPSQMSALHVSPPPSADTPRILPRNRDCRVDLGSEVYR MLREPAEPAASEPKQSGSFRYLQGMLEAGEGGDRPGSGGSRNLKPAASKLGAPLSGLQGLPECT RCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERLYCENHAKARVKPPEGYDVVA VYPNAKVELV hide sequence

Ensembl Acc Id:

ENSRNOP00000064261 ⟸ ENSRNOT00000074616

RefSeq Acc Id:	XP_038941169 ⟸ XM_039085241
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000086241 ⟸ ENSRNOT00000101447

RefSeq Acc Id:	NP_001380802 ⟸ NM_001393873
- Peptide Label:	isoform 4
- UniProtKB:	A0A8I6GEQ8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001380801 ⟸ NM_001393872
- Peptide Label:	isoform 3

RefSeq Acc Id:	NP_001380800 ⟸ NM_001393871
- Peptide Label:	isoform 1
- UniProtKB:	P36202 (UniProtKB/Swiss-Prot)

Protein Domains

LIM zinc-binding PDZ

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P36202-F1-model_v2	AlphaFold	P36202	1-330	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697184

Promoter ID:

EPDNEW_R7709

Type:

initiation region

Name:

Pdlim4_1

Description:

PDZ and LIM domain 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	39,405,284 - 39,405,344	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3575	AgrOrtholog
BioCyc Gene	G2FUF-25121	BioCyc
Ensembl Genes	ENSRNOG00000050794	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000074616	ENTREZGENE
	ENSRNOT00000101447	ENTREZGENE
Gene3D-CATH	2.30.42.10	UniProtKB/Swiss-Prot
	Cysteine Rich Protein	UniProtKB/Swiss-Prot
InterPro	DUF4749	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
	PDZ-LIM_domain	UniProtKB/Swiss-Prot
	PDZ_sf	UniProtKB/Swiss-Prot
	Znf_LIM	UniProtKB/Swiss-Prot
KEGG Report	rno:24915	UniProtKB/Swiss-Prot
NCBI Gene	24915	ENTREZGENE
PANTHER	PDZ AND LIM DOMAIN PROTEIN 4	UniProtKB/Swiss-Prot
	PDZ AND LIM DOMAIN PROTEIN ZASP	UniProtKB/Swiss-Prot
Pfam	DUF4749	UniProtKB/Swiss-Prot
	LIM	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
PhenoGen	Pdlim4	PhenoGen
PROSITE	LIM_DOMAIN_1	UniProtKB/Swiss-Prot
	LIM_DOMAIN_2	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000050794	RatGTEx
SMART	LIM	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot
	SSF50156	UniProtKB/Swiss-Prot
UniProt	A0A8I6GEQ8	ENTREZGENE, UniProtKB/TrEMBL
	A6HEG3	ENTREZGENE, UniProtKB/TrEMBL
	M0R4H5	ENTREZGENE, UniProtKB/TrEMBL
	P36202	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-07	Pdlim4	PDZ and LIM domain 4	Ril	reversion induced LIM gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ril	Reversion induced LIM gene			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a LIM/double zinc finger domain	633750
gene_physical_interaction	binds alpha-actinin, binding occurs via the Ril PDZ domain	1300470
gene_protein	327-amino acids	68225

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM