Advanced Search (OLGA)

Gene: Rasa2 (RAS p21 protein activator 2) Rattus norvegicus

Analyze

Symbol:

Rasa2

Name:

RAS p21 protein activator 2

RGD ID:

3538

Description:

Enables GTPase activator activity. Predicted to be involved in regulation of intracellular signal transduction. Predicted to be located in plasma membrane. Human ortholog(s) of this gene implicated in Noonan syndrome. Orthologous to human RASA2 (RAS p21 protein activator 2); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GAP1M; ras GTPase-activating protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RASA2 (RAS p21 protein activator 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rasa2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rasa2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RASA2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RASA2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rasa2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RASA2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RASA2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rasa2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rasa2 (RAS p21 protein activator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FAAP24 (FA core complex associated protein 24)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RASA2 (RAS p21 protein activator 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rasa2 (RAS p21 protein activator 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rasa2 (RAS p21 protein activator 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rasa2 (RAS p21 protein activator 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	RasGAP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gap-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gap-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rasa2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	105,996,797 - 106,116,285 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	106,000,002 - 106,116,206 (-)	Ensembl				GRCr8
mRatBN7.2	8	97,119,983 - 97,236,687 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	97,118,802 - 97,236,671 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	102,786,496 - 102,902,394 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	100,985,753 - 101,101,643 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	98,824,714 - 98,940,606 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	104,417,827 - 104,542,313 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	104,414,567 - 104,542,317 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	103,859,311 - 103,988,460 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	101,616,850 - 101,734,769 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	96,563,044 - 96,679,053 (-)	NCBI		Celera
RGSC_v3.1	8	101,635,908 - 101,754,268 (-)	NCBI
RH 3.4 Map	8	1059.99	RGD
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hereditary Neoplastic Syndromes (ISO)

melanoma (ISO)

Noonan syndrome (ISO)

Noonan syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

fenvalerate (EXP)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

L-methionine (ISO)

lithium atom (ISO)

lithium hydride (ISO)

N-nitrosodiethylamine (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular signal transduction (IEA)

negative regulation of Ras protein signal transduction (IEA)

regulation of intracellular signal transduction (IBA)

Cellular Component

plasma membrane (IEA)

Molecular Function

GTPase activator activity (IBA,IDA,IEA)

metal ion binding (IEA)

phospholipid binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Next-generation sequencing identifies rare variants associated with Noonan syndrome.	Chen PC, etal., Proc Natl Acad Sci U S A. 2014 Aug 5;111(31):11473-8. doi: 10.1073/pnas.1324128111. Epub 2014 Jul 21.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	A novel mammalian Ras GTPase-activating protein which has phospholipid-binding and Btk homology regions.	Maekawa M, etal., Mol Cell Biol 1994 Oct;14(10):6879-85.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8226805

Genomics

Comparative Map Data

Rasa2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	105,996,797 - 106,116,285 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	106,000,002 - 106,116,206 (-)	Ensembl				GRCr8
mRatBN7.2	8	97,119,983 - 97,236,687 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	97,118,802 - 97,236,671 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	102,786,496 - 102,902,394 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	100,985,753 - 101,101,643 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	98,824,714 - 98,940,606 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	104,417,827 - 104,542,313 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	104,414,567 - 104,542,317 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	103,859,311 - 103,988,460 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	101,616,850 - 101,734,769 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	96,563,044 - 96,679,053 (-)	NCBI		Celera
RGSC_v3.1	8	101,635,908 - 101,754,268 (-)	NCBI
RH 3.4 Map	8	1059.99	RGD
Cytogenetic Map	8	q31	NCBI

RASA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	141,487,027 - 141,615,344 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	141,486,967 - 141,615,345 (+)	Ensembl			hg38	GRCh38
GRCh37	3	141,205,869 - 141,334,186 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	142,688,616 - 142,813,887 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	142,688,623 - 142,813,895	NCBI
Celera	3	139,629,479 - 139,754,949 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI
HuRef	3	138,580,937 - 138,706,253 (+)	NCBI		HuRef
CHM1_1	3	141,169,053 - 141,294,259 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	144,234,722 - 144,362,958 (+)	NCBI		T2T-CHM13v2.0

Rasa2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	96,421,353 - 96,513,665 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	96,421,353 - 96,513,670 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	96,539,300 - 96,631,612 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	96,539,300 - 96,631,617 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	96,439,719 - 96,531,922 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	96,351,797 - 96,440,845 (-)	NCBI		MGSCv36	mm8
Celera	9	96,098,648 - 96,190,756 (-)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	50.66	NCBI

Rasa2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955508	4,100,525 - 4,196,753 (-)	Ensembl
ChiLan1.0	NW_004955508	4,097,455 - 4,199,954 (-)	NCBI	ChiLan1.0	ChiLan1.0

RASA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	139,396,840 - 139,525,928 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	139,401,573 - 139,530,661 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	138,520,013 - 138,648,798 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	146,108,019 - 146,245,637 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	146,108,019 - 146,245,637 (+)	Ensembl			panPan2	panpan1.1

RASA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	37,298,422 - 37,509,234 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	37,411,022 - 37,506,844 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	37,348,977 - 37,501,906 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	37,886,431 - 38,039,822 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	37,915,985 - 38,039,813 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	37,569,880 - 37,722,763 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	37,647,104 - 37,800,458 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	37,889,916 - 38,043,155 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rasa2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	76,581,661 - 76,672,136 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	3,321,479 - 3,408,901 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	3,321,458 - 3,410,715 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RASA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	82,230,178 - 82,352,756 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	82,230,138 - 82,352,759 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	90,125,160 - 90,191,809 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RASA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	48,995,847 - 49,118,895 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	48,995,848 - 49,118,824 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	21,931,589 - 22,054,632 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rasa2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	18,119,727 - 18,250,815 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	18,119,663 - 18,253,854 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rasa2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	87,987,393 - 88,087,481 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rasa2
793 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	22
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000016327
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	97492344	116428905	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

RH132500

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,117,349 - 97,117,563 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,422,959 - 104,423,172	NCBI	Rnor6.0
Rnor_6.0	8	104,414,728 - 104,414,941	NCBI	Rnor6.0
Rnor_5.0	8	103,865,558 - 103,865,771	UniSTS	Rnor5.0
Rnor_5.0	8	103,857,761 - 103,857,974	UniSTS	Rnor5.0
RGSC_v3.4	8	101,613,751 - 101,613,964	UniSTS	RGSC3.4
Celera	8	96,559,945 - 96,560,158	UniSTS
RH 3.4 Map	8	1058.5	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH94824

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,120,057 - 97,120,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,417,436 - 104,417,683	NCBI	Rnor6.0
Rnor_5.0	8	103,860,469 - 103,860,716	UniSTS	Rnor5.0
RGSC_v3.4	8	101,616,459 - 101,616,706	UniSTS	RGSC3.4
Celera	8	96,562,653 - 96,562,900	UniSTS
RH 3.4 Map	8	1059.99	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH143376

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,120,104 - 97,120,247 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,417,483 - 104,417,625	NCBI	Rnor6.0
Rnor_5.0	8	103,860,516 - 103,860,658	UniSTS	Rnor5.0
RGSC_v3.4	8	101,616,506 - 101,616,648	UniSTS	RGSC3.4
Celera	8	96,562,700 - 96,562,842	UniSTS
RH 3.4 Map	8	1051.3	UniSTS
Cytogenetic Map	8	q31	UniSTS

BARC0073

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,180,284 - 97,180,503 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	225,740,516 - 225,740,721 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	246,142,301 - 246,142,505	NCBI	Rnor6.0
Rnor_6.0	8	104,484,176 - 104,484,394	NCBI	Rnor6.0
Rnor_5.0	8	103,926,775 - 103,926,993	UniSTS	Rnor5.0
Rnor_5.0	1	253,386,006 - 253,386,210	UniSTS	Rnor5.0
RGSC_v3.4	1	231,632,995 - 231,633,199	UniSTS	RGSC3.4
RGSC_v3.4	8	101,677,756 - 101,677,974	UniSTS	RGSC3.4
Celera	8	96,622,999 - 96,623,217	UniSTS
Celera	1	222,907,133 - 222,907,337	UniSTS
Cytogenetic Map	1	q52	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	355	192	11	144	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010053933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016327 ⟹ ENSRNOP00000016327

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	106,000,002 - 106,116,206 (-)	Ensembl
mRatBN7.2 Ensembl	8	97,118,802 - 97,236,671 (-)	Ensembl
Rnor_6.0 Ensembl	8	104,414,567 - 104,542,317 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000173992 ⟹ ENSRNOP00000105066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	106,000,002 - 106,116,066 (-)	Ensembl

RefSeq Acc Id:

NM_001105724 ⟹ NP_001099194

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,000,002 - 106,116,206 (-)	NCBI
mRatBN7.2	8	97,120,449 - 97,236,661 (-)	NCBI
Rnor_6.0	8	104,417,827 - 104,542,313 (-)	NCBI
Rnor_5.0	8	103,859,311 - 103,988,460 (-)	NCBI
RGSC_v3.4	8	101,616,850 - 101,734,769 (-)	RGD
Celera	8	96,563,044 - 96,679,053 (-)	RGD

Sequence:

show sequence

GGGCGGCACCATGGCGGCGGCAGCGCCTGCTGCGGCGGCTTTAACCGAGGCGCCGGCCGTCCCG
GGCACCGCAGAACCCGAGACGGGAGACGAGGACAGTCGTGAGGTCCGAGTGCTGCAGAGCCTGC
GCGGCAGGATCTATGAAGCAAAAAATTTATTGCCATATCTTGGACCCAACAAAATGCGGGATTG
TTTCTGCACTATAAATTTGGACCAGGAAGAAGTTTATCGCACCCAGGTTGTTGAAAAGTCTTTA
AGTCCATATTTCAGTGAAGAATTTTATTTTGAGATTCCAAGAACTTTCCAGTATTTGTCATTTT
ATGTTTATGATAAAAATGTTTTACAAAGAGATCTTCGTATAGGAAAAGTAGCCATCAAAAAAGA
AGACTTGTGCAGTCATAGTGGTAAAGAAACTTGGTTTTCATTGCAGCCTATTGACTCAAATTCA
GAAGTTCAGGGAAAAGTTCACCTTGAATTAAAACTGAATGAATTGATAACAGAAAATGGAACTG
TGTGCCAGCAGCTTGTTGTACACATCAAGGCATGCCACGGGTTGCCTCTTATCAATGGACAAAG
CTGTGATCCTTACGCAACAGTTTCCCTCGTGGGCCCTTCCAGGAATGACCAAAAGAAGACAAAA
GTAAAGAAGAAAACAAGCAATCCACAGTTCAATGAAGTCTTCTACTTTGAGGTAACCAGATCCA
GCAGTTACACCAGGAAGTCCCAGTTCCAGGTGGAGGAGGAAGACATTGAGAAGCTGGAAATCAG
GATTGACTTGTGGAATAATGAAAACCTAGTTCAAGATGTTTTCCTGGGGGAGATTAAGGTTCCT
GTCAATGTGTTAAGAAATGATTCCTCTCATCAAGCCTGGTACTTGCTACAACCAAGAGACAATG
GAAACAAGTCGTCTAAACCTGATGACCTGGGATCCCTCCTGTTAACTCTGTGTTACACAGAAGA
CTACGTGCTCCCATCAGAGTACTATGGACCCTTGAAAGCTTTGCTGCTAAAATCACCAGATGTT
CAGCCAGTATCCGCCTCAGCTGCTTATATTTTGGGTGAAATATGTCGAGACCAGAAGGATGCCG
TTTTGCCCCTCGTACGACTGTTGCTGCATCACAATAAGCTTGTTCCCTTTATCACTGCGGTGGC
TGACCTGGACTTGAAGGATACTCAAGATGCCAACGCAATATTTAGAGGAAACTCCCTGGCTACC
CAGTGTCTGACTGAGATGATGAAGATAGTGGGAGGGCACTACCTGAAAGTCACATTGAAGCCTG
TTCTGGATGAGATATGTGAGTCCTCGAAATCCTGTGAAATAGATCCTGTTAAGTTGAAAGAGGG
AGATAATGTGGAGAGTAATAAGGAGAATCTGTACTACTATGTGGACAAAGTATTCAGTGCGATC
GTAGGATCAAGTGTGAGCTGTCCCACTGTGATGTGTGATATTTTTTATTCTCTGAGACAGATGG
CTGCTAAGAGATTTCCTAATAACCCTCATGTTCAGTACTCTGCCGTGAGCAGCTTTGTGTTTCT
TCGTTTCTTTGCTGTAGCGATTCTGTCACCTCATGCTTTTCATTTGCGACCTCATTATCCAGAT
ACACAGACAGTTAGGACTTTAACTCTCATCTCAAAAACCATTCAGATTATTGGAAACTGGGGAT
GTCAATCCAGAAGAAAGTCACGGTTCAAAAAGTCAGTCATGTGTGAATTTCTCAAAATGTTTCA
AGAAGAAAGGTATTTTACAGACGTGAAAAAGTTCTTGGATGAAATTTCGTCTACGGAAACTAAG
GAGTCCAGTGGTACGAGTGAGCCTGTGCACCTGAAAGAAGGTGAGATGTATAAAAGAGCTCAAG
GAAGAACCCGTATTGGAAAAAAGAACTTCAAGAAACGATGGTTCTGCTTGACAAGCAAAGAGCT
CACCTACCACAAACAGCAAGGCAAAGATGCAATTTACACTATTCCAGTAAAGAACATTCTTGCT
GTGGAAAAACTGGAAGAAAGCTCTTTCAACAAGAAAAATATGTTCCAAGTGATCCATACGGAGA
AAACGCTGTACATCCAAGCGAATAACTGTGTGGAAGCTAATGAGTGGATCGACATGCTGTGCAG
GGTGAGCAGGTGCAACCACAACAGGCTCAGCTCCTTCCACCCGTCAGCATATCTCAACGGAAAC
TGGCTCTGCTGCCAGGAGACCAGTGAAGGCACACCAGGCTGCAAGCCATGCACTGCAGGCATCC
CTGCAGACATCCAGATAGATATTGATGAAGACAGAGAAACAGAAAGAATTTACTCCGTTTTTAC
CCTCAGTTTACTTAAACTGCAGAAGATGGAAGAGGCTTGTGGGTCTATAGCTGTATATCAGGGG
CCACAGAAAGAACCTGGTTATTCTAAGTTCACCATCGAGGATTCTGTCGCAACCTTTAAGACAA
TTCAGCAAATAAAAAGCACCATAGAGAAACTAGATGAACCTCATGAGAAATACAGGAAGAAAAG
ATCGAGTAGTGCAAAATACGGAAGCAAGGAAAATCCAATTGTGGGAAAAATATCATAGTG

hide sequence

RefSeq Acc Id:

XM_039080892 ⟹ XP_038936820

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	105,996,797 - 106,116,232 (-)	NCBI
mRatBN7.2	8	97,119,983 - 97,236,687 (-)	NCBI

RefSeq Acc Id:

XM_063264951 ⟹ XP_063121021

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,034,637 - 106,116,285 (-)	NCBI

RefSeq Acc Id:

XM_063264952 ⟹ XP_063121022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,042,285 - 106,116,284 (-)	NCBI

RefSeq Acc Id:

XR_010053933

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,031,143 - 106,116,284 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099194	(Get FASTA)	NCBI Sequence Viewer
	XP_038936820	(Get FASTA)	NCBI Sequence Viewer
	XP_063121021	(Get FASTA)	NCBI Sequence Viewer
	XP_063121022	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL77494	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016327
	ENSRNOP00000016327.4
GenBank Protein	Q63713	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099194 ⟸ NM_001105724

- UniProtKB:

Q63713 (UniProtKB/Swiss-Prot), A6I283 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAAPAAAALTEAPAVPGTAEPETGDEDSREVRVLQSLRGRIYEAKNLLPYLGPNKMRDCFCT
INLDQEEVYRTQVVEKSLSPYFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGKVAIKKEDLC
SHSGKETWFSLQPIDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKACHGLPLINGQSCDP
YATVSLVGPSRNDQKKTKVKKKTSNPQFNEVFYFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDL
WNNENLVQDVFLGEIKVPVNVLRNDSSHQAWYLLQPRDNGNKSSKPDDLGSLLLTLCYTEDYVL
PSEYYGPLKALLLKSPDVQPVSASAAYILGEICRDQKDAVLPLVRLLLHHNKLVPFITAVADLD
LKDTQDANAIFRGNSLATQCLTEMMKIVGGHYLKVTLKPVLDEICESSKSCEIDPVKLKEGDNV
ESNKENLYYYVDKVFSAIVGSSVSCPTVMCDIFYSLRQMAAKRFPNNPHVQYSAVSSFVFLRFF
AVAILSPHAFHLRPHYPDTQTVRTLTLISKTIQIIGNWGCQSRRKSRFKKSVMCEFLKMFQEER
YFTDVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSKELTYH
KQQGKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHTEKTLYIQANNCVEANEWIDMLCRVSR
CNHNRLSSFHPSAYLNGNWLCCQETSEGTPGCKPCTAGIPADIQIDIDEDRETERIYSVFTLSL
LKLQKMEEACGSIAVYQGPQKEPGYSKFTIEDSVATFKTIQQIKSTIEKLDEPHEKYRKKRSSS
AKYGSKENPIVGKIS

hide sequence

Ensembl Acc Id:

ENSRNOP00000016327 ⟸ ENSRNOT00000016327

RefSeq Acc Id:	XP_038936820 ⟸ XM_039080892
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063121021 ⟸ XM_063264951
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063121022 ⟸ XM_063264952
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000105066 ⟸ ENSRNOT00000173992

Protein Domains

C2 PH Ras-GAP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63713-F1-model_v2	AlphaFold	Q63713	1-847	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696194

Promoter ID:

EPDNEW_R6719

Type:

initiation region

Name:

Rasa2_1

Description:

RAS p21 protein activator 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	104,542,357 - 104,542,417	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3538	AgrOrtholog
BioCyc Gene	G2FUF-29451	BioCyc
Ensembl Genes	ENSRNOG00000011909	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016327	ENTREZGENE
	ENSRNOT00000016327.6	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
	2.60.40.150	UniProtKB/Swiss-Prot
	GTPase Activation - p120gap, domain 1	UniProtKB/Swiss-Prot
InterPro	C2_dom	UniProtKB/Swiss-Prot
	C2_domain_sf	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
	Ras_GTPase	UniProtKB/Swiss-Prot
	RASA2_PH	UniProtKB/Swiss-Prot
	RasGAP_CS	UniProtKB/Swiss-Prot
	RasGAP_dom	UniProtKB/Swiss-Prot
	Rho_GTPase_activation_prot	UniProtKB/Swiss-Prot
	Znf_Btk_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:25597	UniProtKB/Swiss-Prot
NCBI Gene	25597	ENTREZGENE
PANTHER	PTHR10194	UniProtKB/Swiss-Prot
	RAS GTPASE-ACTIVATING PROTEIN 2	UniProtKB/Swiss-Prot
Pfam	BTK	UniProtKB/Swiss-Prot
	PF00168	UniProtKB/Swiss-Prot
	PF00169	UniProtKB/Swiss-Prot
	RasGAP	UniProtKB/Swiss-Prot
PhenoGen	Rasa2	PhenoGen
PRINTS	TECBTKDOMAIN	UniProtKB/Swiss-Prot
PROSITE	PH_DOMAIN	UniProtKB/Swiss-Prot
	PS50004	UniProtKB/Swiss-Prot
	RAS_GTPASE_ACTIV_1	UniProtKB/Swiss-Prot
	RAS_GTPASE_ACTIV_2	UniProtKB/Swiss-Prot
	ZF_BTK	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011909	RatGTEx
SMART	BTK	UniProtKB/Swiss-Prot
	RasGAP	UniProtKB/Swiss-Prot
	SM00233	UniProtKB/Swiss-Prot
	SM00239	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
	SSF48350	UniProtKB/Swiss-Prot
	SSF49562	UniProtKB/Swiss-Prot
UniProt	A0ABK0LJW4_RAT	UniProtKB/TrEMBL
	A6I283	ENTREZGENE, UniProtKB/TrEMBL
	Q63713	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rasa2	RAS p21 protein activator 2			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	has domains with similarity to the synaptotagamin phospholipid-binding domain and to a Btk tyrosine kinase domain	729718

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)