Advanced Search (OLGA)

Gene: Pdc (phosducin) Rattus norvegicus

Analyze

Symbol:

Pdc

Name:

phosducin

RGD ID:

3277

Description:

Predicted to be involved in regulation of G protein-coupled receptor signaling pathway and visual perception. Predicted to be located in several cellular components, including cilium; cytosol; and photoreceptor inner segment. Predicted to be active in photoreceptor outer segment. Orthologous to human PDC (phosducin); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

33 kDa phototransducing protein; 33DPTP; MEKA; PHD; Phototransducing protein 33 kDa (phosducin); Phototransducing protein, 33 kDa (phosducin); rod photoreceptor 1; RPR-1; Rpr1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDC (phosducin)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pdc (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdc (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDC (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDC (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdc (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDC (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDC (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdc (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pdc (phosducin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PDC (phosducin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdc (phosducin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdcb (phosducin b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdca (phosducin a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mau-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7650	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG7650	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pdc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Pdc^em2Mcwi ; Pdc^em3Mcwi

Genetic Models:

SS-Pdc^em2Mcwi ; SS-Pdc^em3Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	64,847,366 - 64,921,865 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	64,908,307 - 64,921,865 (+)	Ensembl				GRCr8
mRatBN7.2	13	62,297,281 - 62,371,754 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	62,358,196 - 62,371,754 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	64,998,016 - 65,011,575 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	66,275,990 - 66,289,477 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	63,537,222 - 63,550,763 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	67,545,430 - 67,558,600 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	67,545,430 - 67,558,600 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	72,510,251 - 72,523,421 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	64,622,473 - 64,636,031 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	62,323,686 - 62,337,185 (+)	NCBI		Celera
RGSC_v3.1	13	64,636,552 - 64,650,111 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

methimazole (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of G protein-coupled receptor signaling pathway (IEA)

visual perception (IEA)

Cellular Component

cytosol (IEA)

nucleus (IEA)

photoreceptor inner segment (IEA)

photoreceptor outer segment (IBA,IEA,ISO)

Molecular Function

protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Analysis of the human, bovine and rat 33-kDa proteins and cDNA in retina and pineal gland.	Abe T, etal., Gene 1990 Jul 16;91(2):209-15.
2.	Rat pineal gland phosducin: cDNA isolation, nucleotide sequence, and chromosomal assignment in the mouse.	Craft CM, etal., Genomics 1991 Jun;10(2):400-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Amino acid and cDNA sequence of bovine phosducin, a soluble phosphoprotein from photoreceptor cells.	Lee RH, etal., J Biol Chem 1990 Sep 15;265(26):15867-73.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Rethinking the role of phosducin: light-regulated binding of phosducin to 14-3-3 in rod inner segments.	Nakano K, etal., Proc Natl Acad Sci U S A. 2001 Apr 10;98(8):4693-8. Epub 2001 Apr 3.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding.	Thulin CD, etal., J Biol Chem. 2001 Jun 29;276(26):23805-15. Epub 2001 Apr 30.

Additional References at PubMed

PMID:10360181	PMID:14973130	PMID:16421094	PMID:17569665	PMID:18367617	PMID:23199924	PMID:25971962	PMID:28402877

Genomics

Comparative Map Data

Pdc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	64,847,366 - 64,921,865 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	64,908,307 - 64,921,865 (+)	Ensembl				GRCr8
mRatBN7.2	13	62,297,281 - 62,371,754 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	62,358,196 - 62,371,754 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	64,998,016 - 65,011,575 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	66,275,990 - 66,289,477 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	63,537,222 - 63,550,763 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	67,545,430 - 67,558,600 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	67,545,430 - 67,558,600 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	72,510,251 - 72,523,421 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	64,622,473 - 64,636,031 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	62,323,686 - 62,337,185 (+)	NCBI		Celera
RGSC_v3.1	13	64,636,552 - 64,650,111 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

PDC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	186,443,566 - 186,461,114 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	186,443,566 - 186,461,114 (-)	Ensembl			hg38	GRCh38
GRCh37	1	186,412,698 - 186,430,246 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	184,679,337 - 184,696,862 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	183,144,373 - 183,161,896	NCBI
Celera	1	159,523,438 - 159,540,966 (-)	NCBI		Celera
Cytogenetic Map	1	q31.1	NCBI
HuRef	1	157,647,242 - 157,664,785 (-)	NCBI		HuRef
CHM1_1	1	187,834,441 - 187,851,962 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	185,798,329 - 185,815,896 (-)	NCBI		T2T-CHM13v2.0

Pdc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	150,195,168 - 150,209,657 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	150,195,168 - 150,209,657 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	150,319,417 - 150,333,906 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	150,319,417 - 150,333,906 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	152,166,547 - 152,181,036 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	152,081,635 - 152,096,124 (+)	NCBI		MGSCv36	mm8
Celera	1	152,758,050 - 152,772,537 (+)	NCBI		Celera
Cytogenetic Map	1	G1	NCBI
cM Map	1	63.84	NCBI

Pdc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	24,857,642 - 24,873,307 (-)	Ensembl
ChiLan1.0	NW_004955406	24,857,791 - 24,873,057 (-)	NCBI	ChiLan1.0	ChiLan1.0

PDC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	63,270,733 - 63,283,638 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	62,952,116 - 62,965,009 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	161,969,161 - 161,976,816 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	166,122,181 - 166,145,947 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	166,122,181 - 166,145,947 (-)	Ensembl			panPan2	panpan1.1

PDC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	19,498,785 - 19,514,225 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	19,498,788 - 19,514,228 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	19,020,407 - 19,035,847 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	19,234,869 - 19,250,306 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	19,234,872 - 19,250,306 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	19,141,771 - 19,157,188 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	19,251,031 - 19,266,481 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	19,382,072 - 19,397,756 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pdc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	86,128,092 - 86,148,682 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	3,974,682 - 3,995,423 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	3,974,831 - 3,995,431 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	127,601,385 - 127,619,697 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	127,600,114 - 127,619,759 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	140,053,493 - 140,073,532 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	42,983,682 - 42,990,191 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	42,984,036 - 42,989,769 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	44,170,667 - 44,179,290 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624814	7,190,805 - 7,198,229 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624814	7,150,941 - 7,198,327 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pdc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	29,786,066 - 29,792,566 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pdc
807 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	313
Count of miRNA genes:	196
Interacting mature miRNAs:	223
Transcripts:	ENSRNOT00000003405
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat

Markers in Region

BG371888

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	62,371,331 - 62,371,556 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	67,558,178 - 67,558,402	NCBI	Rnor6.0
Rnor_5.0	13	72,522,999 - 72,523,223	UniSTS	Rnor5.0
RGSC_v3.4	13	64,635,609 - 64,635,833	UniSTS	RGSC3.4
Celera	13	62,336,763 - 62,336,987	UniSTS
RH 3.4 Map	13	299.6	UniSTS
Cytogenetic Map	13	q21	UniSTS

Genetic Models

This gene Pdc is modified in the following models/strains:

SS-Pdc^em2Mcwi SS-Pdc^em3Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	4	13	95	25	23	6	21	6	5	76	50	1	83	12	33	17	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M33528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M33530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M60738	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003405 ⟹ ENSRNOP00000003405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	64,908,307 - 64,921,865 (+)	Ensembl
mRatBN7.2 Ensembl	13	62,358,196 - 62,371,754 (+)	Ensembl
Rnor_6.0 Ensembl	13	67,545,430 - 67,558,600 (+)	Ensembl

RefSeq Acc Id:

NM_012872 ⟹ NP_037004

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,908,307 - 64,921,865 (+)	NCBI
mRatBN7.2	13	62,358,196 - 62,371,754 (+)	NCBI
Rnor_6.0	13	67,545,430 - 67,558,600 (+)	NCBI
Rnor_5.0	13	72,510,251 - 72,523,421 (+)	NCBI
RGSC_v3.4	13	64,622,473 - 64,636,031 (+)	RGD
Celera	13	62,323,686 - 62,337,185 (+)	RGD

Sequence:

show sequence

CAGAGATTCTCACCCACTGGACATAATCTAGGACTCCAGGAACAGAGACCCCAAACTACTACAC
CGAACACAACCCATAAAATGGAAGAAGCCGCAAGCCAAAGCTTAGAGGAAGATTTTGAAGGACA
GGCCACACACACAGGACCCAAAGGAGTAATAAATGACTGGAGAAAGTTTAAATTAGAAAGTGAA
GATGGTGATTCAATTCCACCCAGCAAGAAGGAGATCCTCAGACAAATGTCCTCTCCTCAGAGCA
GAGATGACAAAGACTCGAAAGAAAGAATGAGCAGAAAGATGAGCATTCAAGAATATGAACTAAT
TCATCAGGACAAAGAAGATGAAGGTTGCCTTCGCAAATACCGCAGACAGTGCATGCAGGATATG
CATCAGAAGCTGAGCTTTGGGCCTAGGTATGGGTTTGTGTATGAGCTGGAAACAGGGGAGCAAT
TCCTGGAAACCATCGAAAAGGAGCAGAAGGTCACCACCATCGTGGTTAACATTTACGAGGATGG
TGTCAGGGGCTGTGACGCACTCAACAGCAGTTTAGAATGCCTTGCAGCAGAGTACCCAATGGTC
AAGTTCTGTAAAATAAGAGCTTCGAATACTGGAGCTGGGGACCGCTTTTCCTCAGACGTACTCC
CGACATTGCTCATATACAAAGGTGGGGAGCTCATAAGCAATTTTATTAGTGTCGCTGAACAATT
TGCCGAAGATTTTTTCGCTGCGGATGTGGAGTCTTTCCTAAATGAATATGGCTTACTACCAGAA
AGAGAGATACATGACCTAGGGCAGACCAACACGGAAGATGAAGATATCGAGTAAGCACGCACGG
TGCAGTATCTCGTGACTATCCTTTGCACAGTGAACATCGATGGTTTTTTTGGTAGTATCTATAT
TCCTTTAGCAAACACTAAATACAGTCAGGCCAACTCAAATTGGGGAGGGGACACTAAAATTATG
TAAATAGCATTTTTAGTACTAATTATTCAAATTGAGATAATATTTTACTGCAAAAAATATTGTG
GTTCTGAGCAAATAACTACTGAACAGAGGAGGTGGGTGATGTCAACGTTAGGTCATTGTAAAAA
TCCCTTTCCAGTTCCGTGTTAGCTTATTACTCCTCCTTTTCCCCTTGGCATTTATTTTTGGGCT
TTTGAGGCTGAATGCTACTTATAAATTGGTTTGTATGATAAGAATAAAGTCCTATGAAGAAACA
AATAGTCTGTCTAAAGTCTGCCGTGAGTCAAGGACTTAAAAACTTCATAAAGCTTT

hide sequence

RefSeq Acc Id:

XM_039090380 ⟹ XP_038946308

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,847,366 - 64,921,806 (+)	NCBI
mRatBN7.2	13	62,297,295 - 62,371,695 (+)	NCBI

RefSeq Acc Id:

XM_039090382 ⟹ XP_038946310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,847,366 - 64,890,240 (+)	NCBI
mRatBN7.2	13	62,297,281 - 62,339,768 (+)	NCBI

RefSeq Acc Id:

XM_063272041 ⟹ XP_063128111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,847,366 - 64,921,806 (+)	NCBI

RefSeq Acc Id:

XM_063272042 ⟹ XP_063128112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,847,366 - 64,921,806 (+)	NCBI

RefSeq Acc Id:

XM_063272043 ⟹ XP_063128113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	64,847,366 - 64,921,806 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037004	(Get FASTA)	NCBI Sequence Viewer
	XP_038946308	(Get FASTA)	NCBI Sequence Viewer
	XP_038946310	(Get FASTA)	NCBI Sequence Viewer
	XP_063128111	(Get FASTA)	NCBI Sequence Viewer
	XP_063128112	(Get FASTA)	NCBI Sequence Viewer
	XP_063128113	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40603	(Get FASTA)	NCBI Sequence Viewer
	AAA40604	(Get FASTA)	NCBI Sequence Viewer
	AAA41841	(Get FASTA)	NCBI Sequence Viewer
	EDM09585	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003405
	ENSRNOP00000003405.3
GenBank Protein	P20942	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037004 ⟸ NM_012872

- UniProtKB:

Q63420 (UniProtKB/Swiss-Prot), P20942 (UniProtKB/Swiss-Prot), A6ICR2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDS
KERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIE
KEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLIY
KGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNTEDEDIE

hide sequence

Ensembl Acc Id:

ENSRNOP00000003405 ⟸ ENSRNOT00000003405

RefSeq Acc Id:	XP_038946310 ⟸ XM_039090382
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038946308 ⟸ XM_039090380
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063128111 ⟸ XM_063272041
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063128112 ⟸ XM_063272042
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063128113 ⟸ XM_063272043
- Peptide Label:	isoform X2

Protein Domains

Phosducin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20942-F1-model_v2	AlphaFold	P20942	1-246	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3277	AgrOrtholog
BioCyc Gene	G2FUF-17946	BioCyc
Ensembl Genes	ENSRNOG00000002517	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003405	ENTREZGENE
	ENSRNOT00000003405.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.168.10	UniProtKB/Swiss-Prot
	Glutaredoxin	UniProtKB/Swiss-Prot
InterPro	Phosducin	UniProtKB/Swiss-Prot
	Phosducin-like_reg	UniProtKB/Swiss-Prot
	Phosducin_N_dom_sf	UniProtKB/Swiss-Prot
	Phosducin_thioredoxin-like_dom	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:25343	UniProtKB/Swiss-Prot
NCBI Gene	25343	ENTREZGENE
PANTHER	PHOSDUCIN	UniProtKB/Swiss-Prot
	PHOSDUCIN-LIKE PROTEIN	UniProtKB/Swiss-Prot
Pfam	Phosducin	UniProtKB/Swiss-Prot
PhenoGen	Pdc	PhenoGen
PRINTS	PHOSDUCIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002517	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot
UniProt	A6ICR2	ENTREZGENE, UniProtKB/TrEMBL
	P20942	ENTREZGENE, UniProtKB/Swiss-Prot
	Q63420	ENTREZGENE
UniProt Secondary	Q63420	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-11-06	Pdc	phosducin		Phototransducing protein, 33 kDa (phosducin)	Name updated	625702	APPROVED
2002-06-10	Pdc	Phototransducing protein, 33 kDa (phosducin)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the pineal gland and in the retina	729603

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message