Advanced Search (OLGA)

Gene: Pacsin1 (protein kinase C and casein kinase substrate in neurons 1) Rattus norvegicus

Analyze

Symbol:

Pacsin1

Name:

protein kinase C and casein kinase substrate in neurons 1

RGD ID:

3247

Description:

Enables phospholipid binding activity. Involved in several processes, including plasma membrane tubulation; positive regulation of dendrite development; and regulation of postsynaptic neurotransmitter receptor internalization. Located in axon terminus; perinuclear region of cytoplasm; and plasma membrane. Is active in glutamatergic synapse and postsynaptic density membrane. Orthologous to human PACSIN1 (protein kinase C and casein kinase substrate in neurons 1); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dynamin PRD-interacting protein; dynamin proline-rich domain-interacting protein; protein kinase C and casein kinase substrate in neurons protein 1; sdpI; synaptic, dynamin-associated protein I; syndapin 1; syndapin I; syndapin-1; syndapin-I

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	5,719,929 - 5,769,492 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	5,721,311 - 5,767,109 (+)	Ensembl				GRCr8
mRatBN7.2	20	5,718,134 - 5,768,064 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	5,719,857 - 5,765,313 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	6,432,443 - 6,477,979 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,794,221 - 5,839,766 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	6,273,992 - 6,319,361 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	7,241,248 - 7,286,702 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	7,279,820 - 7,286,586 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	9,443,609 - 9,489,048 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	5,875,450 - 5,921,738 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	7,282,963 - 7,327,615 (+)	NCBI		Celera
RGSC_v3.1	20	5,875,676 - 5,921,965 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP)

bortezomib (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cordycepin (ISO)

D-glucose (ISO)

entinostat (ISO)

folic acid (ISO)

fucoxanthin (ISO)

fulvestrant (ISO)

genistein (EXP)

glucose (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

mercaptopurine (EXP)

methamphetamine (EXP)

mono(2-ethylhexyl) phthalate (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

propanal (ISO)

purine-6-thiol (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

WIN 55212-2 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IEA)

cytoskeleton organization (IBA,IDA)

endocytosis (IEA)

negative regulation of endocytosis (ISO)

neuron development (IEA)

neuron projection morphogenesis (IBA,IMP)

plasma membrane tubulation (IBA,IEA,IMP,ISO)

positive regulation of dendrite development (IBA,IDA)

protein localization to membrane (IEA,ISO,ISS)

protein localization to plasma membrane (IDA)

regulation of endocytosis (IBA,IEA)

regulation of postsynaptic neurotransmitter receptor internalization (IDA,IMP)

synaptic vesicle endocytosis (IEA,ISO,ISS)

Cellular Component

axon terminus (IDA)

cell projection (IEA)

COPI-coated vesicle (IEA,ISO)

cytoplasm (IBA,IEA,ISO,ISS)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

cytosol (IEA)

endosome (IBA)

glutamatergic synapse (IDA,IMP)

membrane (IEA)

neuron projection (IEA)

perinuclear region of cytoplasm (IDA)

photoreceptor ribbon synapse (IEA,ISO)

plasma membrane (IBA,IDA,IEA)

postsynaptic density membrane (IDA)

presynaptic endocytic zone (IEA,ISO)

ruffle membrane (IEA,ISO,ISS)

synapse (IDA,IEA)

terminal bouton (HDA)

Molecular Function

cytoskeletal protein binding (IEA,ISO)

identical protein binding (IEA,ISO)

lipid binding (IEA)

phospholipid binding (IBA,IDA,IEA,ISO)

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cordon-bleu is an actin nucleation factor and controls neuronal morphology.	Ahuja R, etal., Cell. 2007 Oct 19;131(2):337-50.
2.	Syndapin I and endophilin I bind overlapping proline-rich regions of dynamin I: role in synaptic vesicle endocytosis.	Anggono V and Robinson PJ, J Neurochem. 2007 Aug;102(3):931-43. Epub 2007 Apr 16.
3.	Syndapin I is the phosphorylation-regulated dynamin I partner in synaptic vesicle endocytosis.	Anggono V, etal., Nat Neurosci. 2006 Jun;9(6):752-60. doi: 10.1038/nn1695. Epub 2006 Apr 30.
4.	PICK1 interacts with PACSIN to regulate AMPA receptor internalization and cerebellar long-term depression.	Anggono V, etal., Proc Natl Acad Sci U S A. 2013 Aug 20;110(34):13976-81. doi: 10.1073/pnas.1312467110. Epub 2013 Aug 5.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	The Actin Nucleator Cobl Is Controlled by Calcium and Calmodulin.	Hou W, etal., PLoS Biol. 2015 Sep 3;13(9):e1002233. doi: 10.1371/journal.pbio.1002233. eCollection 2015.
8.	Syndapins integrate N-WASP in receptor-mediated endocytosis.	Kessels MM and Qualmann B, EMBO J 2002 Nov 15;21(22):6083-94.
9.	Interaction of SPIN90 with syndapin is implicated in clathrin-mediated endocytic pathway in fibroblasts.	Kim SH, etal., Genes Cells. 2006 Oct;11(10):1197-211.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Endocytosis and synaptic removal of NR3A-containing NMDA receptors by PACSIN1/syndapin1.	Pérez-Otaño I, etal., Nat Neurosci. 2006 May;9(5):611-21. doi: 10.1038/nn1680. Epub 2006 Apr 16.
13.	Syndapin I, a synaptic dynamin-binding protein that associates with the neural Wiskott-Aldrich syndrome protein.	Qualmann B, etal., Mol Biol Cell 1999 Feb;10(2):501-13.
14.	Phosphorylation of syndapin I F-BAR domain at two helix-capping motifs regulates membrane tubulation.	Quan A, etal., Proc Natl Acad Sci U S A. 2012 Mar 6;109(10):3760-5. doi: 10.1073/pnas.1108294109. Epub 2012 Feb 21.
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I.	Schwintzer L, etal., EMBO J. 2011 Jul 1;30(15):3147-59. doi: 10.1038/emboj.2011.207.
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	The Ras/Rac guanine nucleotide exchange factor mammalian Son-of-sevenless interacts with PACSIN 1/syndapin I, a regulator of endocytosis and the actin cytoskeleton.	Wasiak S, etal., J Biol Chem 2001 Jul 13;276(28):26622-8.
21.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
22.	Selection of ligands by panning of domain libraries displayed on phage lambda reveals new potential partners of synaptojanin 1.	Zucconi A, etal., J Mol Biol. 2001 Apr 13;307(5):1329-39.

Additional References at PubMed

PMID:9746365	PMID:11082044	PMID:15865439	PMID:15930129	PMID:16540475	PMID:17634366	PMID:19101610	PMID:19549836	PMID:20404169	PMID:21640082	PMID:21926968	PMID:22871113
PMID:23785143	PMID:24509844	PMID:27488904	PMID:28131823	PMID:28235806	PMID:34290082

Genomics

Comparative Map Data

Pacsin1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	5,719,929 - 5,769,492 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	5,721,311 - 5,767,109 (+)	Ensembl				GRCr8
mRatBN7.2	20	5,718,134 - 5,768,064 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	5,719,857 - 5,765,313 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	6,432,443 - 6,477,979 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,794,221 - 5,839,766 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	6,273,992 - 6,319,361 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	7,241,248 - 7,286,702 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	7,279,820 - 7,286,586 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	9,443,609 - 9,489,048 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	5,875,450 - 5,921,738 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	7,282,963 - 7,327,615 (+)	NCBI		Celera
RGSC_v3.1	20	5,875,676 - 5,921,965 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

PACSIN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	34,466,076 - 34,535,223 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	34,466,061 - 34,535,229 (+)	Ensembl			hg38	GRCh38
GRCh37	6	34,433,853 - 34,503,000 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	34,541,883 - 34,610,978 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	34,541,882 - 34,610,976	NCBI
Celera	6	35,988,242 - 36,057,336 (+)	NCBI		Celera
Cytogenetic Map	6	p21.31	NCBI
HuRef	6	34,156,470 - 34,225,623 (+)	NCBI		HuRef
CHM1_1	6	34,436,833 - 34,505,990 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	34,289,922 - 34,359,072 (+)	NCBI		T2T-CHM13v2.0

Pacsin1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	27,874,565 - 27,930,092 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	27,874,483 - 27,930,456 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	27,655,591 - 27,711,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	27,655,509 - 27,711,482 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	27,792,627 - 27,848,051 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	27,383,271 - 27,438,695 (+)	NCBI		MGSCv36	mm8
Celera	17	28,208,328 - 28,262,887 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	14.59	NCBI

Pacsin1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	2,634,056 - 2,666,098 (+)	Ensembl
ChiLan1.0	NW_004955437	2,621,013 - 2,665,194 (+)	NCBI	ChiLan1.0	ChiLan1.0

PACSIN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	48,936,406 - 49,005,653 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	44,803,788 - 44,873,037 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	34,030,769 - 34,100,029 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	35,131,697 - 35,201,440 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	35,180,099 - 35,201,440 (+)	Ensembl			panPan2	panpan1.1

PACSIN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	3,754,075 - 3,811,717 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	3,753,717 - 3,809,986 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	3,769,517 - 3,827,580 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	4,090,836 - 4,148,898 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	4,090,725 - 4,148,893 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	3,752,394 - 3,810,382 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	3,833,730 - 3,891,767 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	3,932,863 - 3,990,934 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pacsin1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	39,337,736 - 39,386,124 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	24,571,877 - 24,622,707 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	24,574,106 - 24,622,494 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PACSIN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	30,492,589 - 30,512,739 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	30,459,851 - 30,512,736 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	35,237,179 - 35,244,167 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PACSIN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	37,565,059 - 37,630,637 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	37,563,714 - 37,574,063 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	34,389,671 - 34,457,426 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pacsin1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	22,723,317 - 22,734,344 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	22,723,479 - 22,762,262 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pacsin1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	6,143,716 - 6,191,238 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pacsin1
349 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	23
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000037772
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3626323	10078622	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3626323	9244918	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH138881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	5,765,108 - 5,765,235 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	7,286,498 - 7,286,624	NCBI	Rnor6.0
Rnor_5.0	20	9,488,844 - 9,488,970	UniSTS	Rnor5.0
RGSC_v3.4	20	5,921,534 - 5,921,660	UniSTS	RGSC3.4
Celera	20	7,327,411 - 7,327,537	UniSTS
RH 3.4 Map	20	57.54	UniSTS
Cytogenetic Map	20	p12	UniSTS

AA858870

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	20	5,769,326 - 5,769,465 (+)	Marker Load Pipeline
mRatBN7.2	20	5,767,530 - 5,767,669 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	7,288,920 - 7,289,058	NCBI	Rnor6.0
Rnor_5.0	20	9,491,266 - 9,491,404	UniSTS	Rnor5.0
RGSC_v3.4	20	5,923,956 - 5,924,094	UniSTS	RGSC3.4
Celera	20	7,329,833 - 7,329,971	UniSTS
RH 3.4 Map	20	71.9	UniSTS
Cytogenetic Map	20	p12	UniSTS

BE095567

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	5,767,873 - 5,768,026 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	7,289,263 - 7,289,415	NCBI	Rnor6.0
Rnor_5.0	20	9,491,609 - 9,491,761	UniSTS	Rnor5.0
RGSC_v3.4	20	5,924,299 - 5,924,451	UniSTS	RGSC3.4
Celera	20	7,330,176 - 7,330,328	UniSTS
RH 3.4 Map	20	59.1	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF104402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000090820 ⟹ ENSRNOP00000069980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	5,721,311 - 5,767,109 (+)	Ensembl
mRatBN7.2 Ensembl	20	5,719,857 - 5,765,313 (+)	Ensembl
Rnor_6.0 Ensembl	20	7,279,820 - 7,286,586 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094726 ⟹ ENSRNOP00000089554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	5,721,311 - 5,767,109 (+)	Ensembl
mRatBN7.2 Ensembl	20	5,759,888 - 5,765,313 (+)	Ensembl

RefSeq Acc Id:

NM_017294 ⟹ NP_058990

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	5,721,660 - 5,767,109 (+)	NCBI
mRatBN7.2	20	5,719,857 - 5,765,313 (+)	NCBI
Rnor_6.0	20	7,241,248 - 7,286,702 (+)	NCBI
Rnor_5.0	20	9,443,609 - 9,489,048 (+)	NCBI
RGSC_v3.4	20	5,875,450 - 5,921,738 (+)	RGD
Celera	20	7,282,963 - 7,327,615 (+)	RGD

Sequence:

show sequence

CCGGGAAGCCATCCGGGCTTGAGGCTGGGCCGCCGCCGCCGCCGCCGCCCACTTTGCTACCCGC
CCCGCCGATGGTGTCCGGTGCTCCGGCACCCAGCCTGTGAGCAGCGAGCTAACTGCAGATCCAC
GCCTGCCCAGCTCCCTACAGTTGCGCCATGTCTGGCCCCTACGATGAGGCCTCGGAGGAGATCA
CAGATAGCTTCTGGGAGGTGGGGAACTACAAGCGGACGGTGAAGCGCATCGACGATGGGCACCG
CTTGTGCAACGACCTCATGAGCTGCGTGCAGGAGCGCGCCAAGATCGAGAAGGCATACGCGCAG
CAGCTCACCGACTGGGCCAAGCGCTGGCGCCAGCTCATCGAGAAAGGTCCCCAGTATGGCAGCC
TGGAGCGGGCCTGGGGCGCCATGATGACTGAGGCAGACAAAGTCAGCGAGCTGCACCAGGAGGT
GAAGAACAGCCTACTGAACGAGGACCTGGAGAAAGTCAAGAACTGGCAGAAGGATGCCTACCAC
AAGCAGATCATGGGCGGCTTCAAGGAGACGAAGGAGGCGGAGGATGGCTTCCGAAAGGCTCAGA
AGCCCTGGGCTAAGAAGATGAAGGAGCTGGAGGCAGCCAAGAAGGCCTATCACTTGGCTTGCAA
GGAGGAGAAGTTGGCCATGACCCGGGAGATGAACAGTAAGACGGAGCAGTCGGTCACCCCTGAA
CAGCAGAAGAAACTTGTGGATAAAGTGGACAAATGCAGGCAGGATGTACAAAAGACTCAGGAGA
AGTATGAGAAGGTGCTGGAAGATGTGGGCAAGACCACACCGCAGTACATGGAGGGTATGGAGCA
GGTGTTCGAGCAGTGCCAGCAGTTTGAGGAGAAGCGGCTGGTCTTCCTGAAGGAAGTCCTGCTA
GATATCAAACGGCATCTCAACCTAGCGGAGAACAGCAGCTACATTCACGTCTATCGAGAACTGG
AGCAGGCCATCCGAGGGGCCGATGCCCAGGAGGACCTCAGGTGGTTCCGTAGCACCAGTGGCCC
CGGGATGCCCATGAACTGGCCGCAGTTCGAGGAGTGGAACCCAGACCTCCCCCACACCGCTGCC
AAGAAGGAGAAACAGCCTAAGAAGGCAGAGGGGGCCGCCCTGAGCAATGCCACTGGGGCTGTAG
AATCTACATCCCAGGCTGGGGACCGTGGCAGTGTCAGCAGCTATGACCGAGGCCAAGCGTATGC
CACCGAGTGGTCAGACGATGAGAGCGGAAACCCCTTTGGGGGGAACGAGGCCAATGGTGGCGCC
AACCCCTTCGAGGACGATGCCAAGGGAGTTCGTGTACGGGCACTCTATGACTACGACGGTCAGG
AGCAGGATGAGCTCAGCTTCAAGGCCGGAGACGAGCTCACCAAGCTCGGAGAGGAGGACGAACA
GGGTTGGTGCCGCGGGCGGCTGGACAGCGGGCAGCTGGGCCTCTATCCTGCCAACTACGTTGAG
GCTATATAGCTACTTTGCCCACCCGCCTCCTCTCACTCCTTGTCCACCGCCTTCTGCCCTTCCC
CTCCCCTCGCCATAGAGTTCCAGACATATTTTCCGATCAAGCTTTTATTTTTTTAAAAGTC

hide sequence

RefSeq Acc Id:

XM_039098628 ⟹ XP_038954556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	5,750,664 - 5,769,492 (+)	NCBI
mRatBN7.2	20	5,748,864 - 5,768,064 (+)	NCBI

RefSeq Acc Id:

XM_039098629 ⟹ XP_038954557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	5,719,929 - 5,769,492 (+)	NCBI
mRatBN7.2	20	5,718,134 - 5,768,064 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_058990	(Get FASTA)	NCBI Sequence Viewer
	XP_038954556	(Get FASTA)	NCBI Sequence Viewer
	XP_038954557	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD16887	(Get FASTA)	NCBI Sequence Viewer
	EDL96895	(Get FASTA)	NCBI Sequence Viewer
	EDL96896	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000089554
GenBank Protein	Q9Z0W5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058990 ⟸ NM_017294

- UniProtKB:

Q9Z0W5 (UniProtKB/Swiss-Prot), A0A0G2JWR2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGPYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRW
RQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKE
TKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLVDKV
DKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLA
ENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTAAKKEKQPKKA
EGAALSNATGAVESTSQAGDRGSVSSYDRGQAYATEWSDDESGNPFGGNEANGGANPFEDDAKG
VRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI

hide sequence

Ensembl Acc Id:

ENSRNOP00000069980 ⟸ ENSRNOT00000090820

RefSeq Acc Id:	XP_038954557 ⟸ XM_039098629
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JWR2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038954556 ⟸ XM_039098628
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JWR2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000089554 ⟸ ENSRNOT00000094726

Protein Domains

F-BAR SH3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z0W5-F1-model_v2	AlphaFold	Q9Z0W5	1-441	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3247	AgrOrtholog
BioCyc Gene	G2FUF-4462	BioCyc
Ensembl Genes	ENSRNOG00000054603	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000094726	ENTREZGENE
Gene3D-CATH	1.20.1270.60	UniProtKB/Swiss-Prot
	SH3 Domains	UniProtKB/Swiss-Prot
InterPro	AH/BAR_dom_sf	UniProtKB/Swiss-Prot
	F_BAR	UniProtKB/Swiss-Prot
	FCH_dom	UniProtKB/Swiss-Prot
	PACSIN1/PACSIN2_SH3	UniProtKB/Swiss-Prot
	PACSIN1_F-BAR	UniProtKB/Swiss-Prot
	SH3-like_dom_sf	UniProtKB/Swiss-Prot
	SH3_domain	UniProtKB/Swiss-Prot
KEGG Report	rno:29704	UniProtKB/Swiss-Prot
NCBI Gene	29704	ENTREZGENE
PANTHER	PROLINE-SERINE-THREONINE PHOSPHATASE INTERACTING PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR23065:SF16	UniProtKB/Swiss-Prot
Pfam	FCH	UniProtKB/Swiss-Prot
	SH3_9	UniProtKB/Swiss-Prot
PhenoGen	Pacsin1	PhenoGen
PRINTS	SH3DOMAIN	UniProtKB/Swiss-Prot
PROSITE	F_BAR	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000054603	RatGTEx
SMART	FCH	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF103657	UniProtKB/Swiss-Prot
	SSF50044	UniProtKB/Swiss-Prot
TIGR	TC220296
UniProt	A0A0G2JWR2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A7J3_RAT	UniProtKB/TrEMBL
	A6JJM9_RAT	UniProtKB/TrEMBL
	PACN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Pacsin1	protein kinase C and casein kinase substrate in neurons 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	interacts with dynamin I, synaptojanin, and synapsin I; interaction occurs via the pacsin 1 src homology 3 (SH3) domain	69919
gene_physical_interaction	binds mSos by interacting with the mSos1 proline-rich domain	68674
gene_physical_interaction	binds mSos by interacting with the mSos1 proline-rich domain	69919
gene_process	functions in endocytosis and regulation of actin dynamics	68674
gene_process	functions in endocytosis and regulation of actin dynamics	69919
gene_process	may function with Sos1 in regulation of actin dynamics	68674
gene_process	may function with Sos1 in regulation of actin dynamics	69919

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message