Symbol:
Aadat
Name:
aminoadipate aminotransferase
RGD ID:
2948
Description:
Enables 2-aminoadipate transaminase activity; kynurenine-glyoxylate transaminase activity; and kynurenine-oxoglutarate transaminase activity. Predicted to be involved in 2-oxoglutarate metabolic process; glutamate metabolic process; and kynurenine metabolic process. Is active in cytosol and mitochondrial matrix. Orthologous to human AADAT (aminoadipate aminotransferase); PARTICIPATES IN tryptophan metabolic pathway; 2-aminoadipic 2-oxoadipic aciduria pathway; glutaric aciduria type I pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2-aminoadipate aminotransferase; 2-aminoadipate transaminase; alpha-aminoadipate aminotransferase; glycine transaminase AADAT; KAT/AadAT; Kat2; kynurenine aminotransferase 2; kynurenine aminotransferase II; kynurenine--glyoxylate transaminase AADAT; kynurenine--oxoglutarate aminotransferase II; kynurenine--oxoglutarate transaminase 2; kynurenine--oxoglutarate transaminase II; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; methionine--glyoxylate transaminase AADAT
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AADAT (aminoadipate aminotransferase)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Aadat (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AADAT (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AADAT (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Aadat (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AADAT (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AADAT (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Aadat (aminoadipate aminotransferase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Aadat (aminoadipate aminotransferase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AADAT (aminoadipate aminotransferase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aadat (aminoadipate aminotransferase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARO8
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARO9
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector)
Drosophila melanogaster (fruit fly):
CG6321
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
aadat
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 34,520,236 - 34,566,388 (-) NCBI GRCr8 mRatBN7.2 16 29,509,392 - 29,544,332 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 29,509,394 - 29,544,332 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 33,104,268 - 33,139,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 36,538,015 - 36,572,956 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 32,738,925 - 32,773,893 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 32,832,001 - 32,868,680 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 32,832,061 - 32,868,702 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 32,665,727 - 32,705,543 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 32,845,006 - 32,885,600 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 32,845,082 - 32,885,675 (-) NCBI Celera 16 29,503,305 - 29,538,406 (-) NCBI Celera Cytogenetic Map 16 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Aadat Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AADAT mRNA] CTD PMID:31150632 Aadat Rat 1,1-dichloroethene decreases expression ISO Aadat (Mus musculus) 6480464 vinylidene chloride results in decreased expression of AADAT mRNA CTD PMID:26682919 Aadat Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of AADAT mRNA CTD PMID:25380136 Aadat Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of AADAT mRNA and [Testosterone co-treated with Estradiol] results in increased expression of AADAT mRNA CTD PMID:26496021 and PMID:32741896 Aadat Rat 17beta-estradiol increases expression ISO Aadat (Mus musculus) 6480464 Estradiol results in increased expression of AADAT mRNA CTD PMID:39298647 Aadat Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of AADAT mRNA CTD PMID:32145629 Aadat Rat 17beta-estradiol multiple interactions ISO AADAT (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of AADAT mRNA CTD PMID:30165855 Aadat Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO AADAT (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of AADAT mRNA CTD PMID:29581250 Aadat Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AADAT mRNA CTD PMID:16054898 more ... Aadat Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AADAT mRNA CTD PMID:33387578 Aadat Rat 2,4-diaminotoluene increases expression ISO Aadat (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of AADAT mRNA CTD PMID:22016648 Aadat Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Aadat (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Aadat Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of AADAT mRNA CTD PMID:21346803 Aadat Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:20959002 Aadat Rat 3,3',5-triiodo-L-thyronine decreases activity EXP 6480464 Triiodothyronine results in decreased activity of AADAT protein CTD PMID:32663543 Aadat Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of AADAT mRNA CTD PMID:25380136 Aadat Rat 4,4'-sulfonyldiphenol increases expression ISO Aadat (Mus musculus) 6480464 bisphenol S results in increased expression of AADAT mRNA CTD PMID:39298647 Aadat Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 Thyroxine inhibits the reaction [Propylthiouracil results in decreased activity of AADAT protein] CTD PMID:32663543 Aadat Rat 6-propyl-2-thiouracil decreases activity EXP 6480464 Propylthiouracil results in decreased activity of AADAT protein CTD PMID:32663543 Aadat Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of AADAT mRNA CTD PMID:31881176 Aadat Rat aflatoxin B1 decreases expression ISO Aadat (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of AADAT mRNA CTD PMID:19770486 Aadat Rat aflatoxin B1 decreases expression ISO AADAT (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of AADAT mRNA CTD PMID:21632981 Aadat Rat aldrin increases expression ISO Aadat (Mus musculus) 6480464 Aldrin results in increased expression of AADAT mRNA CTD PMID:18579281 Aadat Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of AADAT mRNA CTD PMID:18355885 Aadat Rat amitriptyline affects expression EXP 6480464 Amitriptyline affects the expression of AADAT mRNA CTD PMID:18355885 Aadat Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AADAT mRNA CTD PMID:16483693 Aadat Rat aristolochic acid A decreases expression ISO AADAT (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of AADAT mRNA CTD PMID:33212167 Aadat Rat Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of AADAT mRNA CTD PMID:18178546 Aadat Rat benzo[a]pyrene decreases expression ISO Aadat (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of AADAT mRNA CTD PMID:19770486 Aadat Rat benzo[a]pyrene decreases expression ISO AADAT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of AADAT mRNA CTD PMID:21632981 Aadat Rat benzo[a]pyrene diol epoxide I decreases expression ISO AADAT (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Aadat Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of AADAT mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of AADAT mRNA CTD PMID:26496021 Aadat Rat bisphenol A decreases expression ISO Aadat (Mus musculus) 6480464 bisphenol A results in decreased expression of AADAT mRNA CTD PMID:33221593 Aadat Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of AADAT gene CTD PMID:28505145 Aadat Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AADAT mRNA CTD PMID:30816183 and PMID:32528016 Aadat Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AADAT mRNA CTD PMID:25181051 and PMID:32145629 Aadat Rat bisphenol F affects expression ISO Aadat (Mus musculus) 6480464 bisphenol F affects the expression of AADAT protein CTD PMID:38266696 Aadat Rat bisphenol F increases expression ISO Aadat (Mus musculus) 6480464 bisphenol F results in increased expression of AADAT mRNA CTD PMID:38266696 Aadat Rat buta-1,3-diene decreases expression ISO Aadat (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of AADAT mRNA CTD PMID:29038090 Aadat Rat cadmium dichloride decreases expression ISO AADAT (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of AADAT mRNA CTD PMID:38568856 Aadat Rat chlorpyrifos decreases expression ISO Aadat (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of AADAT mRNA CTD PMID:37019170 Aadat Rat clofibrate increases expression ISO Aadat (Mus musculus) 6480464 Clofibrate results in increased expression of AADAT mRNA CTD PMID:17585979 and PMID:23811191 Aadat Rat clomipramine affects expression EXP 6480464 Clomipramine affects the expression of AADAT mRNA CTD PMID:18355885 Aadat Rat copper atom multiple interactions ISO AADAT (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of AADAT mRNA CTD PMID:20971185 Aadat Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of AADAT mRNA CTD PMID:22465980 Aadat Rat copper(0) multiple interactions ISO AADAT (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of AADAT mRNA CTD PMID:20971185 Aadat Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of AADAT mRNA CTD PMID:22465980 Aadat Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of AADAT mRNA CTD PMID:26577399 Aadat Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of AADAT mRNA CTD PMID:27523638 Aadat Rat cyclosporin A decreases expression ISO Aadat (Mus musculus) 6480464 Cyclosporine results in decreased expression of AADAT mRNA CTD PMID:19770486 Aadat Rat dicrotophos decreases expression ISO AADAT (Homo sapiens) 6480464 dicrotophos results in decreased expression of AADAT mRNA CTD PMID:28302478 Aadat Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of AADAT mRNA CTD PMID:32341500 Aadat Rat doxorubicin increases expression ISO Aadat (Mus musculus) 6480464 Doxorubicin results in increased expression of AADAT mRNA CTD PMID:22016648 Aadat Rat doxorubicin decreases expression ISO AADAT (Homo sapiens) 6480464 Doxorubicin results in decreased expression of AADAT mRNA CTD PMID:29803840 Aadat Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of AADAT mRNA CTD PMID:29391264 Aadat Rat enzalutamide decreases expression ISO AADAT (Homo sapiens) 6480464 enzalutamide results in decreased expression of AADAT mRNA CTD PMID:29581250 Aadat Rat ethanol decreases expression ISO Aadat (Mus musculus) 6480464 Ethanol results in decreased expression of AADAT mRNA CTD PMID:19167417 Aadat Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of AADAT mRNA CTD PMID:24136188 Aadat Rat furan increases methylation EXP 6480464 furan results in increased methylation of AADAT gene CTD PMID:22079235 Aadat Rat gabapentin decreases activity EXP 6480464 gabapentin results in decreased activity of AADAT protein CTD PMID:16765940 Aadat Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AADAT mRNA CTD PMID:33387578 Aadat Rat imipramine affects expression EXP 6480464 Imipramine affects the expression of AADAT mRNA CTD PMID:18355885 Aadat Rat ketoconazole affects expression EXP 6480464 Ketoconazole affects the expression of AADAT mRNA CTD PMID:18355885 Aadat Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of AADAT mRNA CTD PMID:22641619 Aadat Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of AADAT mRNA CTD PMID:30467583 Aadat Rat N-nitrosodiethylamine decreases expression ISO Aadat (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of AADAT mRNA CTD PMID:24535843 Aadat Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of AADAT mRNA CTD PMID:25380136 Aadat Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of AADAT protein CTD PMID:19716841 Aadat Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of AADAT mRNA CTD PMID:24136188 Aadat Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of AADAT mRNA CTD PMID:33484710 Aadat Rat paracetamol affects expression ISO Aadat (Mus musculus) 6480464 Acetaminophen affects the expression of AADAT mRNA CTD PMID:17562736 Aadat Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of AADAT mRNA CTD PMID:33387578 Aadat Rat paracetamol multiple interactions ISO Aadat (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in decreased expression of AADAT mRNA] CTD PMID:29246445 Aadat Rat paracetamol decreases expression ISO Aadat (Mus musculus) 6480464 Acetaminophen results in decreased expression of AADAT mRNA CTD PMID:29246445 Aadat Rat paracetamol decreases expression ISO AADAT (Homo sapiens) 6480464 Acetaminophen results in decreased expression of AADAT mRNA CTD PMID:25704631 Aadat Rat phenobarbital multiple interactions ISO Aadat (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of AADAT mRNA] CTD PMID:19482888 Aadat Rat phenobarbital decreases expression ISO Aadat (Mus musculus) 6480464 Phenobarbital results in decreased expression of AADAT mRNA CTD PMID:19482888 Aadat Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of AADAT mRNA CTD PMID:33945839 Aadat Rat pirinixic acid increases expression ISO Aadat (Mus musculus) 6480464 pirinixic acid results in increased expression of AADAT mRNA CTD PMID:23811191 Aadat Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of AADAT mRNA CTD PMID:19162173 Aadat Rat quercetin decreases expression ISO AADAT (Homo sapiens) 6480464 Quercetin results in decreased expression of AADAT mRNA CTD PMID:21632981 Aadat Rat rotenone decreases expression ISO Aadat (Mus musculus) 6480464 Rotenone results in decreased expression of AADAT mRNA CTD PMID:22016648 Aadat Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of AADAT protein CTD PMID:29459688 Aadat Rat sodium arsenite decreases expression ISO AADAT (Homo sapiens) 6480464 sodium arsenite results in decreased expression of AADAT mRNA CTD PMID:38568856 Aadat Rat sotorasib multiple interactions ISO AADAT (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of AADAT mRNA CTD PMID:36139627 Aadat Rat sulfasalazine increases expression ISO Aadat (Mus musculus) 6480464 Sulfasalazine results in increased expression of AADAT mRNA CTD PMID:22016648 Aadat Rat sunitinib decreases expression ISO AADAT (Homo sapiens) 6480464 Sunitinib results in decreased expression of AADAT mRNA CTD PMID:31533062 Aadat Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of AADAT mRNA CTD PMID:15885361 Aadat Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of AADAT mRNA and [Testosterone co-treated with Estradiol] results in increased expression of AADAT mRNA CTD PMID:26496021 and PMID:32741896 Aadat Rat tetrachloromethane decreases expression ISO Aadat (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of AADAT mRNA CTD PMID:27339419 more ... Aadat Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AADAT mRNA] CTD PMID:31150632 Aadat Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of AADAT mRNA CTD PMID:31150632 Aadat Rat thalidomide decreases expression ISO Aadat (Mus musculus) 6480464 Thalidomide results in decreased expression of AADAT mRNA CTD PMID:26217789 Aadat Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of AADAT mRNA CTD PMID:23411599 and PMID:34492290 Aadat Rat thyroxine affects activity EXP 6480464 Thyroxine affects the activity of AADAT protein CTD PMID:32663543 Aadat Rat thyroxine multiple interactions EXP 6480464 Thyroxine inhibits the reaction [Propylthiouracil results in decreased activity of AADAT protein] CTD PMID:32663543 Aadat Rat tiagabine decreases activity EXP 6480464 tiagabine results in decreased activity of AADAT protein CTD PMID:16765940 Aadat Rat toluene increases expression EXP 6480464 Toluene results in increased expression of AADAT mRNA CTD PMID:22166486 Aadat Rat trametinib multiple interactions ISO AADAT (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of AADAT mRNA CTD PMID:36139627 Aadat Rat Tributyltin oxide increases expression ISO Aadat (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of AADAT mRNA CTD PMID:18958704 Aadat Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of AADAT mRNA CTD PMID:33387578 Aadat Rat uranium atom affects expression ISO AADAT (Homo sapiens) 6480464 Uranium affects the expression of AADAT mRNA CTD PMID:15672453 Aadat Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of AADAT mRNA CTD PMID:15885361 Aadat Rat valproic acid affects expression ISO AADAT (Homo sapiens) 6480464 Valproic Acid affects the expression of AADAT mRNA CTD PMID:25979313 Aadat Rat vancomycin increases expression ISO Aadat (Mus musculus) 6480464 Vancomycin results in increased expression of AADAT mRNA CTD PMID:18930951 Aadat Rat vigabatrin decreases activity EXP 6480464 Vigabatrin results in decreased activity of AADAT protein CTD PMID:16765940 Aadat Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of AADAT mRNA CTD PMID:22570695 Aadat Rat zoledronic acid decreases expression ISO AADAT (Homo sapiens) 6480464 zoledronic acid results in decreased expression of AADAT mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-diaminotoluene (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) aldrin (ISO) amiodarone (EXP) amitriptyline (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) clofibrate (ISO) clomipramine (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) Cuprizon (EXP) cyclosporin A (ISO) dicrotophos (ISO) diethyl phthalate (EXP) doxorubicin (ISO) endosulfan (EXP) enzalutamide (ISO) ethanol (ISO) flutamide (EXP) furan (EXP) gabapentin (EXP) gentamycin (EXP) imipramine (EXP) ketoconazole (EXP) lead diacetate (EXP) methapyrilene (EXP) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nitrofen (EXP) paracetamol (EXP,ISO) phenobarbital (ISO) PhIP (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercetin (ISO) rotenone (ISO) sodium arsenite (EXP,ISO) sotorasib (ISO) sulfasalazine (ISO) sunitinib (ISO) tauroursodeoxycholic acid (EXP) testosterone (EXP) tetrachloromethane (EXP,ISO) thalidomide (ISO) thioacetamide (EXP) thyroxine (EXP) tiagabine (EXP) toluene (EXP) trametinib (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) uranium atom (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) vancomycin (ISO) vigabatrin (EXP) vinclozolin (EXP) zoledronic acid (ISO)
Molecular Function
2-aminoadipate transaminase activity (IDA,IEA,ISO,ISS) glycine:2-oxoglutarate aminotransferase activity (IEA,ISO,ISS) kynurenine-glyoxylate transaminase activity (IDA,ISO,ISS) kynurenine-oxoglutarate transaminase activity (IBA,IDA,IEA,ISO,ISS) methionine-glyoxylate transaminase activity (IEA,ISO,ISS) protein homodimerization activity (ISO) pyridoxal phosphate binding (IEA) transaminase activity (IEA,TAS) transferase activity (IEA)
1.
Cloning and functional expression of a soluble form of kynurenine/alpha-aminoadipate aminotransferase from rat kidney.
Buchli R, etal., J Biol Chem 1995 Dec 8;270(49):29330-5.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Structure, expression, and function of kynurenine aminotransferases in human and rodent brains.
Han Q, etal., Cell Mol Life Sci. 2010 Feb;67(3):353-68. doi: 10.1007/s00018-009-0166-4. Epub 2009 Oct 15.
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.
Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.
Kynurenine metabolism in vitamin-B-6-deficient rat liver after tryptophan injection.
Takeuchi F and Shibata Y, Biochem J. 1984 Jun 15;220(3):693-9.
15.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.
L-kynurenine aminotransferase and L-alpha-aminoadipate aminotransferase. I. Evidence for identity.
Tobes MC and Mason M, Biochem Biophys Res Commun. 1975 Jan 20;62(2):390-7. doi: 10.1016/s0006-291x(75)80151-3.
Aadat (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 34,520,236 - 34,566,388 (-) NCBI GRCr8 mRatBN7.2 16 29,509,392 - 29,544,332 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 29,509,394 - 29,544,332 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 33,104,268 - 33,139,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 36,538,015 - 36,572,956 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 32,738,925 - 32,773,893 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 32,832,001 - 32,868,680 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 32,832,061 - 32,868,702 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 32,665,727 - 32,705,543 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 32,845,006 - 32,885,600 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 32,845,082 - 32,885,675 (-) NCBI Celera 16 29,503,305 - 29,538,406 (-) NCBI Celera Cytogenetic Map 16 p12 NCBI
AADAT (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 170,060,222 - 170,094,292 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 170,060,222 - 170,091,699 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 170,981,373 - 171,011,538 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 171,217,948 - 171,247,947 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 168,313,662 - 168,343,661 (-) NCBI Celera Cytogenetic Map 4 q33 NCBI HuRef 4 166,736,223 - 166,766,217 (-) NCBI HuRef CHM1_1 4 170,957,912 - 170,987,911 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 173,420,406 - 173,454,472 (-) NCBI T2T-CHM13v2.0
Aadat (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 60,958,877 - 60,998,711 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 60,958,966 - 60,998,711 (+) Ensembl GRCm39 Ensembl GRCm38 8 60,505,843 - 60,545,677 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 60,505,932 - 60,545,677 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 62,984,921 - 63,024,474 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 63,398,266 - 63,437,819 (+) NCBI MGSCv36 mm8 Celera 8 63,093,543 - 63,132,626 (+) NCBI Celera Cytogenetic Map 8 B3.1 NCBI cM Map 8 30.85 NCBI
AADAT (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 167,840,395 - 167,870,662 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 168,196,263 - 168,228,815 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 162,283,569 - 162,313,720 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 174,353,766 - 174,383,471 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 174,353,766 - 174,383,471 (-) Ensembl panpan1.1 panPan2
AADAT (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 20,920,118 - 20,944,251 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 20,920,139 - 20,945,387 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 21,552,316 - 21,578,183 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 21,095,996 - 21,122,120 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 21,095,909 - 21,122,348 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 20,979,787 - 21,005,336 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 20,916,219 - 20,941,386 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 21,013,862 - 21,039,554 (-) NCBI UU_Cfam_GSD_1.0
Aadat (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 21,612,298 - 21,637,776 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936516 2,029,715 - 2,052,041 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936516 2,030,032 - 2,052,025 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AADAT (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 19,768,776 - 19,792,256 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 19,768,816 - 19,792,254 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 21,067,885 - 21,091,280 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AADAT (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 116,268,241 - 116,299,509 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 116,268,253 - 116,298,336 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 96,208,477 - 96,238,271 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Aadat (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 340 Count of miRNA genes: 187 Interacting mature miRNAs: 211 Transcripts: ENSRNOT00000015974 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
AI746383
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 29,534,433 - 29,534,573 (+) MAPPER mRatBN7.2 Rnor_6.0 16 32,858,777 - 32,858,916 NCBI Rnor6.0 Rnor_5.0 16 32,692,503 - 32,692,642 UniSTS Rnor5.0 RGSC_v3.4 16 32,875,697 - 32,875,836 UniSTS RGSC3.4 Celera 16 29,528,506 - 29,528,645 UniSTS Cytogenetic Map 16 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
47
113
91
89
59
22
59
6
211
90
93
45
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015974 ⟹ ENSRNOP00000015974
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 29,509,394 - 29,544,332 (-) Ensembl Rnor_6.0 Ensembl 16 32,832,061 - 32,868,680 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082392 ⟹ ENSRNOP00000073124
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 16 32,832,611 - 32,868,702 (-) Ensembl
RefSeq Acc Id:
NM_017193 ⟹ NP_058889
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 34,520,236 - 34,555,180 (-) NCBI mRatBN7.2 16 29,509,392 - 29,544,332 (-) NCBI Rnor_6.0 16 32,832,059 - 32,868,680 (-) NCBI Rnor_5.0 16 32,665,727 - 32,705,543 (-) NCBI RGSC_v3.4 16 32,845,006 - 32,885,600 (-) RGD Celera 16 29,503,305 - 29,538,406 (-) RGD
Sequence:
GTGGCACTCCGCAGCACTACCCGGAGACAGCTAACAGTGCAGCCCGAGTGATCTGGGAAGCCGTTCTCAGTGACCGACTTTTCTAGTCCTGTTCCACGCGACCAGCAGAGACATGAATTACTCAAGGT TCCTCACTGCAACGAGCCTGGCCAGAAAGACATCCCCTATCAGAGCTACAGTGGAGATAATGAGTAGAGCACCCAAAGACATCATCTCCCTGGCTCCTGGATCTCCGAACCCGAAAGTGTTCCCCTTT AAGTCAGCTGTCTTCACTGTGGAGAACGGAAGCACCATCCGGTTTGAAGGAGAGATGTTTCAAAGGGCCCTCCAATATTCCTCAAGCTATGGAATTCCAGAACTTCTGTCCTGGCTAAAACAGTTGCA AATAAAATTGCATAATCCTCCGACTGTCAACTACTCACCCAACGAAGGACAGATGGACCTCTGCATCACATCTGGCTGTCAAGACGGTCTCTGTAAGGTGTTTGAAATGCTCATCAATCCTGGAGACA CTGTTCTGGTCAATGAACCACTGTATTCAGGAGCCCTTTTTGCAATGAAACCACTGGGCTGCAATTTTATTAGTGTCCCCAGTGATGACTGTGGGATTATTCCAGAGGGTCTCAAAAAAGTACTTTCC CAGTGGAAACCAGAAGATTCCAAGGATCCCACAAAAAGGACTCCAAAATTTCTGTATACTATTCCGAATGGCAACAACCCTACAGGCAACTCGTTGACTGGTGACCGCAAGAAAGAAATCTATGAGCT TGCAAGAAAATATGACTTCCTCATAATAGAAGACGATCCTTACTATTTTCTCCAGTTCACCAAGCCTTGGGAACCAACCTTTCTCTCCATGGATGTTGATGGGAGAGTTATCAGAGCTGACTCCCTTT CAAAAGTTATCTCCTCAGGGCTGAGAGTGGGGTTTATAACTGGCCCCAAGTCCTTGATACAGAGGATTGTTCTCCACACACAAATCTCATCACTGCATCCCTGTACTTTATCACAGCTCATGATATCG GAGCTTCTATACCAGTGGGGAGAAGAGGGTTTCCTGGCCCATGTTGACAGAGCTATTGATTTCTACAAGAACCAGAGGGATTTTATATTGGCAGCTGCAGACAAGTGGTTACGTGGTTTGGCAGAGTG GCATGTTCCCAAAGCTGGCATGTTTCTATGGATTAAAGTTAACGGAATCTCTGATGCAAAAAAACTAATTGAAGAAAAGGCTATTGAAAGAGAGATCTTGTTAGTTCCTGGAAATAGTTTCTTCGTCG ATAATTCAGCCCCCTCCTCCTTCTTCAGAGCATCCTTCTCTCAGGTTACTCCAGCGCAGATGGACTTAGTCTTCCAGAGATTGGCCCAACTCATAAAAGACGTTTCATAAAGAAATCAAACTCAGCAT TGAACTTATAATTTTAAAATAAATTTCCTATACTTTGCTGAAGAAATGGCTGACAGGATGGATCCAGTTTGTGAAATATCTGTGGCAATTTCACTGAACAACTTTGAAGCCCCTTAAAATCCACCGCA TTGCCAAAATAACTTTCTGATATACTTTTGCCCTTTGATTAATTATGAACTAACAAAACATCAAATTTCATTGTTAAAGACCTCTGTAGCTGCTTAATAATGTCCAATAAATTTTTTTGAGCCTAACA TAGACTAACTAACATAGTAAATTGCAAGGGAATTAGTTAAAATGGCCTATAATATGCAGGTTTTTTTCTACTTTAAGGAAATTTCATGAGCATTTACTGCAAAAATTGTTGTAATTTGACAATTATAA ATTACTTTGTAACCGAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_063275270 ⟹ XP_063131340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 34,520,236 - 34,554,913 (-) NCBI
RefSeq Acc Id:
XM_063275271 ⟹ XP_063131341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 34,520,236 - 34,566,388 (-) NCBI
RefSeq Acc Id:
NP_058889 ⟸ NM_017193
- UniProtKB:
Q64602 (UniProtKB/Swiss-Prot), A6KIT5 (UniProtKB/TrEMBL), A0A8L2Q812 (UniProtKB/TrEMBL)
- Sequence:
MNYSRFLTATSLARKTSPIRATVEIMSRAPKDIISLAPGSPNPKVFPFKSAVFTVENGSTIRFEGEMFQRALQYSSSYGIPELLSWLKQLQIKLHNPPTVNYSPNEGQMDLCITSGCQDGLCKVFEML INPGDTVLVNEPLYSGALFAMKPLGCNFISVPSDDCGIIPEGLKKVLSQWKPEDSKDPTKRTPKFLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTKPWEPTFLSMDVDGRVI RADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPG NSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
hide sequence
Ensembl Acc Id:
ENSRNOP00000073124 ⟸ ENSRNOT00000082392
Ensembl Acc Id:
ENSRNOP00000015974 ⟸ ENSRNOT00000015974
RefSeq Acc Id:
XP_063131341 ⟸ XM_063275271
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2Q812 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131340 ⟸ XM_063275270
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q812 (UniProtKB/TrEMBL)
RGD ID: 13700074
Promoter ID: EPDNEW_R10597
Type: initiation region
Name: Aadat_1
Description: aminoadipate aminotransferase
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 32,868,695 - 32,868,755 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Aadat
aminoadipate aminotransferase
Kat2
kynurenine aminotransferase 2
Symbol and Name updated
1299863
APPROVED
2002-06-10
Kat2
kynurenine aminotransferase 2
Name updated
70584
APPROVED
Note Type
Note
Reference
gene_function
converts L-kynurenine into kynurenic acid
69866
gene_protein
soluble protein of 425 amino acid
69866