Symbol:
Inpp5d
Name:
inositol polyphosphate-5-phosphatase D
RGD ID:
2914
Description:
Enables inositol-4,5-bisphosphate 5-phosphatase activity. Predicted to be involved in several processes, including negative regulation of bone resorption; negative regulation of natural killer cell mediated cytotoxicity; and regulation of leukocyte differentiation. Predicted to act upstream of or within several processes, including determination of adult lifespan; negative regulation of B cell proliferation; and regulation of hemopoiesis. Located in actin filament and cortical cytoskeleton. Orthologous to human INPP5D (inositol polyphosphate-5-phosphatase D); PARTICIPATES IN erythropoietin signaling pathway; Fc epsilon receptor mediated signaling pathway; granulocyte-macrophage colony-stimulating factor signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
inositol polyphosphate-5-phosphatase; Inositol polyphosphate-5-phosphatase 145 kDa; Inositol polyphosphate-5-phosphatase, 145 kDa; phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1; phosphatidylinositol-4,5-bisphosphate 5-phosphatase; SH2 domain-containing inositol 5'-phosphatase 1; SH2 domain-containing inositol phosphatase 1; SH2 domain-containing inositol-5'-phosphatase 1; SHIP-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 95,735,533 - 95,840,584 (+) NCBI GRCr8 mRatBN7.2 9 88,287,680 - 88,392,748 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 88,287,677 - 88,392,746 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 96,712,335 - 96,817,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 101,848,406 - 101,953,467 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 100,215,907 - 100,320,982 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 94,745,220 - 94,850,778 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 94,745,217 - 94,850,771 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 94,464,380 - 94,569,984 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 86,576,742 - 86,682,240 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 86,760,159 - 86,865,657 (+) NCBI Celera 9 85,697,060 - 85,801,952 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Inpp5d Rat 1,2-dimethylhydrazine increases expression ISO Inpp5d (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of INPP5D mRNA CTD PMID:22206623 Inpp5d Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of INPP5D mRNA CTD PMID:25380136 Inpp5d Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of INPP5D mRNA CTD PMID:12655037 Inpp5d Rat 17beta-estradiol multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of INPP5D mRNA CTD PMID:30165855 Inpp5d Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of INPP5D mRNA CTD PMID:32741896 Inpp5d Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of INPP5D mRNA CTD PMID:32741896 Inpp5d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of INPP5D mRNA CTD PMID:22298810 Inpp5d Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of INPP5D mRNA CTD PMID:33387578 Inpp5d Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of INPP5D mRNA CTD PMID:34747641 Inpp5d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Inpp5d (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of INPP5D mRNA CTD PMID:26377647 and PMID:28922406 Inpp5d Rat 3,4-methylenedioxymethamphetamine increases expression ISO Inpp5d (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of INPP5D mRNA CTD PMID:26251327 Inpp5d Rat 4,4'-sulfonyldiphenol decreases expression ISO Inpp5d (Mus musculus) 6480464 bisphenol S results in decreased expression of INPP5D mRNA CTD PMID:39298647 Inpp5d Rat 4-hydroxyphenyl retinamide decreases expression ISO Inpp5d (Mus musculus) 6480464 Fenretinide results in decreased expression of INPP5D mRNA CTD PMID:28973697 Inpp5d Rat 5-aza-2'-deoxycytidine affects expression ISO INPP5D (Homo sapiens) 6480464 Decitabine affects the expression of INPP5D mRNA CTD PMID:23300844 Inpp5d Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of INPP5D mRNA CTD PMID:30047161 Inpp5d Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of INPP5D mRNA CTD PMID:31881176 Inpp5d Rat acrylamide decreases expression ISO INPP5D (Homo sapiens) 6480464 Acrylamide results in decreased expression of INPP5D mRNA CTD PMID:32763439 Inpp5d Rat actinomycin D increases expression ISO INPP5D (Homo sapiens) 6480464 Dactinomycin results in increased expression of INPP5D mRNA CTD PMID:38460933 Inpp5d Rat actinomycin D multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of INPP5D mRNA CTD PMID:38460933 Inpp5d Rat aflatoxin B1 increases methylation ISO INPP5D (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of INPP5D intron CTD PMID:30157460 Inpp5d Rat Aflatoxin B2 alpha increases methylation ISO INPP5D (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of INPP5D intron CTD PMID:30157460 Inpp5d Rat all-trans-retinoic acid decreases expression ISO INPP5D (Homo sapiens) 6480464 Tretinoin results in decreased expression of INPP5D mRNA CTD PMID:23830798 and PMID:33167477 Inpp5d Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of INPP5D mRNA CTD PMID:35163327 Inpp5d Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of INPP5D mRNA CTD PMID:30047161 Inpp5d Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of INPP5D mRNA CTD PMID:16483693 Inpp5d Rat antirheumatic drug decreases expression ISO INPP5D (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of INPP5D mRNA CTD PMID:24449571 Inpp5d Rat aripiprazole multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of INPP5D mRNA CTD PMID:31476115 Inpp5d Rat Azoxymethane multiple interactions ISO Inpp5d (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INPP5D mRNA CTD PMID:29950665 Inpp5d Rat benzo[a]pyrene increases expression ISO Inpp5d (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of INPP5D mRNA CTD PMID:21569818 Inpp5d Rat benzo[a]pyrene increases methylation ISO INPP5D (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of INPP5D promoter CTD PMID:27901495 Inpp5d Rat benzo[a]pyrene affects methylation ISO INPP5D (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of INPP5D exon and Benzo(a)pyrene affects the methylation of INPP5D intron CTD PMID:30157460 Inpp5d Rat benzo[a]pyrene increases expression ISO INPP5D (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of INPP5D mRNA CTD PMID:22316170 and PMID:32234424 Inpp5d Rat benzo[e]pyrene increases methylation ISO INPP5D (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of INPP5D intron CTD PMID:30157460 Inpp5d Rat benzo[e]pyrene decreases methylation ISO INPP5D (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of INPP5D exon CTD PMID:30157460 Inpp5d Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of INPP5D mRNA CTD PMID:25181051 Inpp5d Rat bisphenol A increases expression ISO Inpp5d (Mus musculus) 6480464 bisphenol A results in increased expression of INPP5D mRNA CTD PMID:38701888 Inpp5d Rat butanal decreases expression ISO INPP5D (Homo sapiens) 6480464 butyraldehyde results in decreased expression of INPP5D mRNA CTD PMID:26079696 Inpp5d Rat cadmium atom multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of INPP5D mRNA CTD PMID:35301059 Inpp5d Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of INPP5D promoter CTD PMID:22457795 Inpp5d Rat cadmium dichloride multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of INPP5D mRNA CTD PMID:35301059 Inpp5d Rat cadmium dichloride decreases expression ISO INPP5D (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of INPP5D mRNA CTD PMID:38568856 Inpp5d Rat caffeine affects phosphorylation ISO INPP5D (Homo sapiens) 6480464 Caffeine affects the phosphorylation of INPP5D protein CTD PMID:35688186 Inpp5d Rat camptothecin increases expression ISO INPP5D (Homo sapiens) 6480464 Camptothecin results in increased expression of INPP5D mRNA CTD PMID:38460933 Inpp5d Rat cannabidiol decreases expression ISO Inpp5d (Mus musculus) 6480464 Cannabidiol results in decreased expression of INPP5D mRNA CTD PMID:30742662 Inpp5d Rat carbamazepine affects expression ISO INPP5D (Homo sapiens) 6480464 Carbamazepine affects the expression of INPP5D mRNA CTD PMID:25979313 Inpp5d Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of INPP5D mRNA CTD PMID:18668222 Inpp5d Rat chlorpyrifos increases expression ISO Inpp5d (Mus musculus) 6480464 Chlorpyrifos results in increased expression of INPP5D mRNA CTD PMID:37019170 Inpp5d Rat choline multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of INPP5D mRNA CTD PMID:20938992 Inpp5d Rat cisplatin affects expression ISO INPP5D (Homo sapiens) 6480464 Cisplatin affects the expression of INPP5D mRNA CTD PMID:23300844 Inpp5d Rat cisplatin increases expression ISO INPP5D (Homo sapiens) 6480464 Cisplatin results in increased expression of INPP5D mRNA CTD PMID:27392435 Inpp5d Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of INPP5D mRNA CTD PMID:30047161 Inpp5d Rat copper(II) chloride decreases expression ISO INPP5D (Homo sapiens) 6480464 cupric chloride results in decreased expression of INPP5D mRNA CTD PMID:38568856 Inpp5d Rat copper(II) sulfate decreases expression ISO INPP5D (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of INPP5D mRNA CTD PMID:19549813 Inpp5d Rat crocidolite asbestos decreases expression ISO Inpp5d (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of INPP5D mRNA CTD PMID:29279043 Inpp5d Rat deoxynivalenol affects phosphorylation ISO Inpp5d (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of INPP5D protein CTD PMID:23352502 Inpp5d Rat dextran sulfate multiple interactions ISO Inpp5d (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INPP5D mRNA CTD PMID:29950665 Inpp5d Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of INPP5D mRNA CTD PMID:29108742 Inpp5d Rat dicrotophos increases expression ISO INPP5D (Homo sapiens) 6480464 dicrotophos results in increased expression of INPP5D mRNA CTD PMID:28302478 Inpp5d Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of INPP5D mRNA CTD PMID:22546817 Inpp5d Rat dorsomorphin multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Inpp5d Rat ellagic acid increases expression ISO INPP5D (Homo sapiens) 6480464 Ellagic Acid results in increased expression of INPP5D mRNA CTD PMID:12002526 Inpp5d Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of INPP5D mRNA CTD PMID:29391264 and PMID:31464424 Inpp5d Rat entinostat increases expression ISO INPP5D (Homo sapiens) 6480464 entinostat results in increased expression of INPP5D mRNA CTD PMID:26272509 Inpp5d Rat entinostat multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat ethanol multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of INPP5D mRNA CTD PMID:30517762 Inpp5d Rat ethanol affects splicing ISO Inpp5d (Mus musculus) 6480464 Ethanol affects the splicing of INPP5D mRNA CTD PMID:30319688 Inpp5d Rat ethanol increases expression ISO Inpp5d (Mus musculus) 6480464 Ethanol results in increased expression of INPP5D mRNA CTD PMID:30319688 Inpp5d Rat folic acid multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of INPP5D mRNA CTD PMID:20938992 Inpp5d Rat folic acid decreases expression ISO Inpp5d (Mus musculus) 6480464 Folic Acid results in decreased expression of INPP5D mRNA CTD PMID:25629700 Inpp5d Rat folpet decreases expression ISO Inpp5d (Mus musculus) 6480464 folpet results in decreased expression of INPP5D mRNA CTD PMID:31558096 Inpp5d Rat formaldehyde decreases expression ISO INPP5D (Homo sapiens) 6480464 Formaldehyde results in decreased expression of INPP5D mRNA CTD PMID:28937961 Inpp5d Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of INPP5D mRNA CTD PMID:22061828 and PMID:33387578 Inpp5d Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of INPP5D mRNA CTD PMID:20080153 Inpp5d Rat L-methionine multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of INPP5D mRNA CTD PMID:20938992 Inpp5d Rat Lasiocarpine increases expression ISO INPP5D (Homo sapiens) 6480464 lasiocarpine results in increased expression of INPP5D mRNA CTD PMID:32234424 Inpp5d Rat lipopolysaccharide multiple interactions ISO INPP5D (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Inpp5d Rat lipopolysaccharide decreases expression ISO INPP5D (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of INPP5D mRNA CTD PMID:35811015 Inpp5d Rat maneb multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of INPP5D mRNA CTD PMID:36117858 Inpp5d Rat MeIQx increases expression ISO INPP5D (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Inpp5d Rat mercury dibromide increases expression ISO INPP5D (Homo sapiens) 6480464 mercuric bromide results in increased expression of INPP5D mRNA CTD PMID:26272509 Inpp5d Rat mercury dibromide multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat methapyrilene increases methylation ISO INPP5D (Homo sapiens) 6480464 Methapyrilene results in increased methylation of INPP5D intron CTD PMID:30157460 Inpp5d Rat methapyrilene decreases methylation ISO INPP5D (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of INPP5D exon CTD PMID:30157460 Inpp5d Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of INPP5D mRNA CTD PMID:30047161 Inpp5d Rat methylmercury chloride increases expression ISO INPP5D (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of INPP5D mRNA CTD PMID:23179753 more ... Inpp5d Rat methylmercury chloride multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat N-ethyl-N-nitrosourea decreases expression ISO Inpp5d (Mus musculus) 6480464 Ethylnitrosourea results in decreased expression of INPP5D protein CTD PMID:32902906 Inpp5d Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of INPP5D mRNA CTD PMID:25380136 Inpp5d Rat nickel atom increases expression ISO INPP5D (Homo sapiens) 6480464 Nickel results in increased expression of INPP5D mRNA CTD PMID:24768652 and PMID:25583101 Inpp5d Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of INPP5D mRNA CTD PMID:22546817 Inpp5d Rat nitrates multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of INPP5D mRNA CTD PMID:35964746 Inpp5d Rat Nutlin-3 multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of INPP5D mRNA CTD PMID:38460933 Inpp5d Rat Nutlin-3 increases expression ISO INPP5D (Homo sapiens) 6480464 nutlin 3 results in increased expression of INPP5D mRNA CTD PMID:38460933 Inpp5d Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of INPP5D mRNA CTD PMID:25729387 Inpp5d Rat ozone multiple interactions ISO INPP5D (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of INPP5D mRNA and [Aripiprazole co-treated with Ozone] results in increased expression of INPP5D mRNA CTD PMID:31476115 and PMID:35430440 Inpp5d Rat ozone multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of INPP5D mRNA CTD PMID:34911549 Inpp5d Rat ozone increases expression ISO INPP5D (Homo sapiens) 6480464 Ozone results in increased expression of INPP5D mRNA CTD PMID:31476115 Inpp5d Rat p-chloromercuribenzoic acid increases expression ISO INPP5D (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of INPP5D mRNA CTD PMID:26272509 Inpp5d Rat p-chloromercuribenzoic acid multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat panobinostat multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat paracetamol affects expression ISO Inpp5d (Mus musculus) 6480464 Acetaminophen affects the expression of INPP5D mRNA CTD PMID:17562736 Inpp5d Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of INPP5D mRNA CTD PMID:33387578 Inpp5d Rat paracetamol increases expression ISO INPP5D (Homo sapiens) 6480464 Acetaminophen results in increased expression of INPP5D mRNA CTD PMID:22230336 Inpp5d Rat paraquat multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of INPP5D mRNA CTD PMID:36117858 Inpp5d Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of INPP5D mRNA CTD PMID:19162173 Inpp5d Rat phenobarbital affects expression ISO INPP5D (Homo sapiens) 6480464 Phenobarbital affects the expression of INPP5D mRNA CTD PMID:19159669 Inpp5d Rat phenylmercury acetate increases expression ISO INPP5D (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of INPP5D mRNA CTD PMID:26272509 Inpp5d Rat phenylmercury acetate multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat quercitrin affects expression ISO INPP5D (Homo sapiens) 6480464 quercitrin affects the expression of INPP5D mRNA CTD PMID:25193878 Inpp5d Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO INPP5D (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Inpp5d Rat SB 431542 multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Inpp5d Rat silicon dioxide decreases expression ISO INPP5D (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of INPP5D mRNA CTD PMID:25895662 Inpp5d Rat sodium arsenite increases expression ISO INPP5D (Homo sapiens) 6480464 sodium arsenite results in increased expression of INPP5D mRNA CTD PMID:29301061 and PMID:34032870 Inpp5d Rat sodium arsenite decreases expression ISO INPP5D (Homo sapiens) 6480464 sodium arsenite results in decreased expression of INPP5D mRNA CTD PMID:38568856 Inpp5d Rat Soman increases expression EXP 6480464 Soman results in increased expression of INPP5D mRNA CTD PMID:19281266 Inpp5d Rat sotorasib multiple interactions ISO INPP5D (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of INPP5D mRNA CTD PMID:36139627 Inpp5d Rat succimer multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of INPP5D mRNA CTD PMID:21641980 Inpp5d Rat sunitinib increases expression ISO INPP5D (Homo sapiens) 6480464 Sunitinib results in increased expression of INPP5D mRNA CTD PMID:31533062 Inpp5d Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of INPP5D mRNA CTD PMID:32741896 Inpp5d Rat tetrachloromethane multiple interactions ISO Inpp5d (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of INPP5D mRNA CTD PMID:30517762 Inpp5d Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of INPP5D mRNA CTD PMID:34492290 Inpp5d Rat titanium dioxide multiple interactions ISO Inpp5d (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INPP5D mRNA CTD PMID:29950665 Inpp5d Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of INPP5D mRNA CTD PMID:25729387 Inpp5d Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of INPP5D mRNA CTD PMID:25729387 Inpp5d Rat trametinib multiple interactions ISO INPP5D (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of INPP5D mRNA CTD PMID:36139627 Inpp5d Rat tricetin increases expression ISO INPP5D (Homo sapiens) 6480464 tricetin results in increased expression of INPP5D mRNA CTD PMID:38654487 Inpp5d Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of INPP5D mRNA CTD PMID:33387578 Inpp5d Rat trichostatin A increases expression ISO INPP5D (Homo sapiens) 6480464 trichostatin A results in increased expression of INPP5D mRNA CTD PMID:24935251 Inpp5d Rat triphenyl phosphate affects expression ISO INPP5D (Homo sapiens) 6480464 triphenyl phosphate affects the expression of INPP5D mRNA CTD PMID:37042841 Inpp5d Rat triptonide increases expression ISO Inpp5d (Mus musculus) 6480464 triptonide results in increased expression of INPP5D mRNA CTD PMID:33045310 Inpp5d Rat tungsten decreases expression ISO Inpp5d (Mus musculus) 6480464 Tungsten results in decreased expression of INPP5D mRNA CTD PMID:30912803 Inpp5d Rat urethane decreases expression ISO INPP5D (Homo sapiens) 6480464 Urethane results in decreased expression of INPP5D mRNA CTD PMID:28818685 Inpp5d Rat valproic acid increases methylation ISO INPP5D (Homo sapiens) 6480464 Valproic Acid results in increased methylation of INPP5D gene CTD PMID:29154799 Inpp5d Rat valproic acid decreases expression ISO INPP5D (Homo sapiens) 6480464 Valproic Acid results in decreased expression of INPP5D mRNA CTD PMID:28001369 Inpp5d Rat valproic acid multiple interactions ISO INPP5D (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INPP5D mRNA CTD PMID:27188386 Inpp5d Rat valproic acid increases expression ISO INPP5D (Homo sapiens) 6480464 Valproic Acid results in increased expression of INPP5D mRNA CTD PMID:23179753 more ... Inpp5d Rat zinc protoporphyrin decreases expression EXP 6480464 zinc protoporphyrin results in decreased expression of INPP5D protein CTD PMID:25780291
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Inpp5d Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Inpp5d Rat inositol phosphate phosphatase activity enables IEA ARBA:ARBA00027168 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Inpp5d Rat inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity enables IEA RHEA:11392 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Inpp5d Rat inositol-4,5-bisphosphate 5-phosphatase activity IDA 633160 RGD Inpp5d Rat inositol-polyphosphate 5-phosphatase activity enables ISO INPP5D (Homo sapiens) 1624291 PMID:10764818 RGD PMID:10764818 Inpp5d Rat inositol-polyphosphate 5-phosphatase activity enables IEA EC:3.1.3.56 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Inpp5d Rat inositol-polyphosphate 5-phosphatase activity enables IEA UniProtKB:Q92835 and ensembl:ENSP000004053381600115 GO_REF:0000107 Ensembl GO_REF:0000107 Inpp5d Rat phosphatase activity enables IEA InterPro:IPR000300 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Inpp5d Rat phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity enables IEA RHEA:25528 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Inpp5d Rat phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity enables IEA EC:3.1.3.86 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Inpp5d Rat phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity enables IEA EC:3.1.3.36 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Inpp5d Rat phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity enables IEA RHEA:22764 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Inpp5d Rat protein binding IPI Flna (Rattus norvegicus) 2312435 RGD Inpp5d Rat protein binding IPI Fcgr2b (Mus musculus) 2312435 RGD Inpp5d Rat protein binding enables ISO INPP5D (Homo sapiens) 1624291 UniProtKB:O75525 more ... RGD PMID:10382761 more ... Inpp5d Rat protein binding enables ISO INPP5D (Homo sapiens) and UniProtKB:Q92835-2 1624291 UniProtKB:A8MQ03 more ... RGD PMID:32296183 Inpp5d Rat protein binding enables ISO Inpp5d (Mus musculus) and PR:Q9ES52-11624291 UniProtKB:P23727 and PMID:10068665 RGD PMID:10068665 Inpp5d Rat protein binding enables IPI UniProtKB:Q15642-1 13432325 PMID:26751515 IntAct Inpp5d Rat protein binding enables IPI UniProtKB:Q96RU3 13432325 PMID:26751515 IntAct Inpp5d Rat protein binding enables ISO Inpp5d (Mus musculus) 1624291 PR:P08101 more ... RGD PMID:11031258 more ... Inpp5d Rat SH3 domain binding enables IEA UniProtKB-KW:KW-0729 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
External Pathway Database Links
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aripiprazole (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) camptothecin (ISO) cannabidiol (ISO) carbamazepine (ISO) chlorpyrifos (EXP,ISO) choline (ISO) cisplatin (ISO) clotrimazole (EXP) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) deoxynivalenol (ISO) dextran sulfate (ISO) diazinon (EXP) dicrotophos (ISO) dieldrin (EXP) dorsomorphin (ISO) ellagic acid (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) folic acid (ISO) folpet (ISO) formaldehyde (ISO) gentamycin (EXP) ketamine (EXP) L-methionine (ISO) Lasiocarpine (ISO) lipopolysaccharide (ISO) maneb (ISO) MeIQx (ISO) mercury dibromide (ISO) methapyrilene (ISO) methimazole (EXP) methylmercury chloride (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodimethylamine (EXP) nickel atom (ISO) nickel dichloride (EXP) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) quercitrin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) sotorasib (ISO) succimer (ISO) sunitinib (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) tricetin (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) zinc protoporphyrin (EXP)
Biological Process
apoptotic process (IEA) biological_process (ND) determination of adult lifespan (IEA,ISO) immune system process (IEA) immunoglobulin mediated immune response (IEA,ISO) intracellular signal transduction (IEA,ISO) lipid metabolic process (IEA) negative regulation of B cell activation (IEA,ISO) negative regulation of B cell proliferation (IEA,ISO) negative regulation of bone resorption (IBA,IEA,ISO) negative regulation of granulocyte differentiation (IEA,ISO) negative regulation of immune response (IEA,ISO) negative regulation of interleukin-6 production (IEA,ISO) negative regulation of monocyte differentiation (IEA,ISO) negative regulation of natural killer cell mediated cytotoxicity (IEA,ISO) negative regulation of neutrophil differentiation (IBA,IEA,ISO) negative regulation of osteoclast differentiation (IEA,ISO) negative regulation of signal transduction (IBA,IEA,ISO) phosphatidylinositol dephosphorylation (IEA) positive regulation of apoptotic process (IEA,ISO) positive regulation of B cell differentiation (IBA,IEA,ISO) positive regulation of erythrocyte differentiation (IEA,ISO) positive regulation of lymphocyte differentiation (IEA,ISO) regulation of immune response (IBA)
External Pathway Database Links
1.
Metabolic switching of PI3K-dependent lipid signals.
Downes CP, etal., Biochem Soc Trans. 2007 Apr;35(Pt 2):188-92.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Dynamic interactions of Fc gamma receptor IIB with filamin-bound SHIP1 amplify filamentous actin-dependent negative regulation of Fc epsilon receptor I signaling.
Lesourne R, etal., J Immunol. 2005 Feb 1;174(3):1365-73.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.
Frequency and amplitude control of cortical oscillations by phosphoinositide waves.
Xiong D, etal., Nat Chem Biol. 2016 Mar;12(3):159-66. doi: 10.1038/nchembio.2000. Epub 2016 Jan 11.
14.
SH2 domain-containing inositol polyphosphate 5'-phosphatase is the main mediator of the inhibitory action of the mast cell function-associated antigen.
Xu R, etal., J Immunol 2001 Dec 1;167(11):6394-402.
Inpp5d Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 95,735,533 - 95,840,584 (+) NCBI GRCr8 mRatBN7.2 9 88,287,680 - 88,392,748 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 88,287,677 - 88,392,746 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 96,712,335 - 96,817,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 101,848,406 - 101,953,467 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 100,215,907 - 100,320,982 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 94,745,220 - 94,850,778 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 94,745,217 - 94,850,771 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 94,464,380 - 94,569,984 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 86,576,742 - 86,682,240 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 86,760,159 - 86,865,657 (+) NCBI Celera 9 85,697,060 - 85,801,952 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
INPP5D Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 233,060,342 - 233,207,903 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 233,059,967 - 233,207,903 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 233,925,052 - 234,116,549 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 233,633,280 - 233,703,602 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 36 2 233,734,415 - 233,781,288 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 233,851,680 - 233,898,543 NCBI Celera 2 227,689,229 - 227,838,082 (+) NCBI Celera Cytogenetic Map 2 q37.1 NCBI HuRef 2 225,771,888 - 225,851,574 (+) NCBI HuRef HuRef 2 225,855,510 - 225,917,438 (+) NCBI HuRef CHM1_1 2 233,930,801 - 234,001,504 (+) NCBI CHM1_1 CHM1_1 2 234,060,594 - 234,122,681 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 233,547,692 - 233,695,995 (+) NCBI T2T-CHM13v2.0
Inpp5d Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 87,548,034 - 87,648,232 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 87,548,034 - 87,648,229 (+) Ensembl GRCm39 Ensembl GRCm38 1 87,620,312 - 87,720,510 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 87,620,312 - 87,720,507 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 89,516,887 - 89,617,083 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 89,451,550 - 89,551,673 (+) NCBI MGSCv36 mm8 Celera 1 90,584,657 - 90,684,696 (+) NCBI Celera Cytogenetic Map 1 D NCBI cM Map 1 44.44 NCBI
Inpp5d Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955453 2,938,659 - 3,037,211 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955453 2,938,659 - 3,037,211 (-) NCBI ChiLan1.0 ChiLan1.0
INPP5D Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 135,661,459 - 135,810,426 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 135,676,418 - 135,825,387 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 120,287,606 - 120,436,526 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 239,201,762 - 239,350,190 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 239,201,762 - 239,350,190 (+) Ensembl panpan1.1 panPan2
INPP5D Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 44,612,146 - 44,731,347 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 44,611,523 - 44,730,200 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 45,107,368 - 45,226,924 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 44,871,607 - 44,991,203 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 44,871,613 - 44,991,203 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 44,796,019 - 44,915,638 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 44,642,212 - 44,761,876 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 44,797,422 - 44,916,878 (+) NCBI UU_Cfam_GSD_1.0
Inpp5d Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 186,769,492 - 186,893,121 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936525 4,048,492 - 4,154,618 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936525 4,046,609 - 4,154,715 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
INPP5D Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 133,501,092 - 133,626,644 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 133,501,067 - 133,626,647 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 147,601,906 - 147,670,776 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
INPP5D Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 119,093,160 - 119,244,128 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 119,093,781 - 119,244,123 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 80,260,665 - 80,414,305 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Inpp5d
.
Predicted Target Of
Count of predictions: 156 Count of miRNA genes: 118 Interacting mature miRNAs: 138 Transcripts: ENSRNOT00000051338 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 724547 Cm21 Cardiac mass QTL 21 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 79271511 102910209 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 2303178 Bp334 Blood pressure QTL 334 3.7 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 79271511 91616855 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 4889852 Pur26 Proteinuria QTL 26 15 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 77813894 101597663 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 4889943 Bss90 Bone structure and strength QTL 90 4.1 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 9 86369631 92058970 Rat
D9Rat67
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 88,387,943 - 88,388,152 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,845,971 - 94,846,179 NCBI Rnor6.0 Rnor_5.0 9 94,565,182 - 94,565,390 UniSTS Rnor5.0 RGSC_v3.4 9 86,677,437 - 86,677,646 RGD RGSC3.4 RGSC_v3.4 9 86,677,438 - 86,677,646 UniSTS RGSC3.4 RGSC_v3.1 9 86,860,856 - 86,861,065 RGD Celera 9 85,797,206 - 85,797,414 UniSTS SHRSP x BN Map 9 56.8299 UniSTS SHRSP x BN Map 9 56.8299 RGD FHH x ACI Map 9 59.98 RGD Cytogenetic Map 9 q35 UniSTS
D9Got236
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 88,317,849 - 88,318,080 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,775,679 - 94,775,909 NCBI Rnor6.0 Rnor_5.0 9 94,494,839 - 94,495,069 UniSTS Rnor5.0 RGSC_v3.4 9 86,606,909 - 86,607,139 UniSTS RGSC3.4 Celera 9 85,727,224 - 85,727,454 UniSTS Cytogenetic Map 9 q35 UniSTS
RH133650
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 88,392,559 - 88,392,741 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,850,585 - 94,850,766 NCBI Rnor6.0 Rnor_5.0 9 94,569,796 - 94,569,977 UniSTS Rnor5.0 RGSC_v3.4 9 86,682,052 - 86,682,233 UniSTS RGSC3.4 Celera 9 85,801,764 - 85,801,945 UniSTS RH 3.4 Map 4 985.9 UniSTS Cytogenetic Map 9 q35 UniSTS
RH144552
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 88,304,395 - 88,304,502 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,762,329 - 94,762,435 NCBI Rnor6.0 Rnor_5.0 9 94,481,489 - 94,481,595 UniSTS Rnor5.0 RGSC_v3.4 9 86,593,456 - 86,593,562 UniSTS RGSC3.4 Celera 9 85,713,771 - 85,713,877 UniSTS Cytogenetic Map 9 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000051338 ⟹ ENSRNOP00000040111
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 88,287,677 - 88,392,746 (+) Ensembl Rnor_6.0 Ensembl 9 94,745,217 - 94,850,771 (+) Ensembl
RefSeq Acc Id:
NM_019311 ⟹ NP_062184
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 95,735,533 - 95,840,584 (+) NCBI mRatBN7.2 9 88,287,680 - 88,392,748 (+) NCBI Rnor_6.0 9 94,745,220 - 94,850,773 (+) NCBI Rnor_5.0 9 94,464,380 - 94,569,984 (+) NCBI RGSC_v3.4 9 86,576,742 - 86,682,240 (+) RGD Celera 9 85,697,060 - 85,801,952 (+) RGD
Sequence:
GCGGCCGCGGAAGTTCTCTGCAGCTCAGTTTCCTCTCCCTCGCTGAGCGCCTGAAACAGGAAGTCAGTCAGTTAAGCTGGTAGTAGCAGCAGAGGCAGCTTCTGAGAGGCCACAGGCGGCAGGTCTCA
hide sequence
RefSeq Acc Id:
NP_062184 ⟸ NM_019311
- UniProtKB:
P97573 (UniProtKB/Swiss-Prot), F1M981 (UniProtKB/TrEMBL)
- Sequence:
MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYALCVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIEFYKKENMGLVTHLQFPVPLEEEDAIDEPEEDTESVMSPPEL
hide sequence
Ensembl Acc Id:
ENSRNOP00000040111 ⟸ ENSRNOT00000051338
RGD ID: 13696839 Promoter ID: EPDNEW_R7363 Type: initiation region Name: Inpp5d_1 Description: inositol polyphosphate-5-phosphatase D SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 94,745,292 - 94,745,352 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Inpp5d
inositol polyphosphate-5-phosphatase D
Inositol polyphosphate-5-phosphatase, 145 kDa
Name updated
625702 APPROVED
2001-05-08
Inpp5d
Inositol polyphosphate-5-phosphatase
Name withdrawn, does not match Human and Mouse nomenclature
62408 WITHDRAWN
2001-05-08
Inpp5d
Inositol polyphosphate-5-phosphatase, 145 kDa
Name changed to reflect Human and Mouse nomenclature
62408 APPROVED
