Symbol:
Igf2r
Name:
insulin-like growth factor 2 receptor
RGD ID:
2871
Description:
Enables several functions, including G-protein alpha-subunit binding activity; insulin-like growth factor II binding activity; and retinoic acid binding activity. Involved in several processes, including animal organ regeneration; response to retinoic acid; and response to tetrachloromethane. Located in several cellular components, including late endosome; perinuclear region of cytoplasm; and trans-Golgi network. Part of clathrin coat. Used to study lung adenocarcinoma. Biomarker of amyotrophic lateral sclerosis. Human ortholog(s) of this gene implicated in diabetes mellitus (multiple); hepatocellular carcinoma; in situ carcinoma (multiple); and nephroblastoma. Orthologous to human IGF2R (insulin like growth factor 2 receptor); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cation-independent mannose-6-phosphate receptor; IGF-IIR; Igfr2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,526,878 - 50,615,265 (+) NCBI GRCr8 mRatBN7.2 1 47,979,109 - 48,067,501 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,979,109 - 48,067,501 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,670,745 - 48,759,134 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,656,245 - 54,744,657 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,746,270 - 48,834,659 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 48,176,095 - 48,264,482 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 48,176,106 - 48,264,477 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,488,767 - 51,577,141 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 42,253,273 - 42,341,646 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 42,256,217 - 42,344,589 (+) NCBI Celera 1 43,778,518 - 43,867,238 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Igf2r Rat (1->4)-beta-D-glucan multiple interactions ISO Igf2r (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IGF2R mRNA CTD PMID:36331819 Igf2r Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of IGF2R protein CTD PMID:17337753 Igf2r Rat 1,2-dimethylhydrazine multiple interactions ISO Igf2r (Mus musculus) 6480464 [1 more ... CTD PMID:22206623 and PMID:26388957 Igf2r Rat 1,2-dimethylhydrazine decreases expression ISO Igf2r (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of IGF2R mRNA CTD PMID:22206623 Igf2r Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of IGF2R mRNA CTD PMID:25380136 Igf2r Rat 17alpha-ethynylestradiol multiple interactions ISO Igf2r (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of IGF2R mRNA more ... CTD PMID:17942748 more ... Igf2r Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of IGF2R mRNA CTD PMID:26496021 Igf2r Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO IGF2R (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Igf2r Rat 2,3',4,4',5-Pentachlorobiphenyl decreases methylation ISO Igf2r (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Igf2r Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Igf2r (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Igf2r (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of IGF2R mRNA CTD PMID:17942748 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IGF2R mRNA CTD PMID:33387578 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Igf2r (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IGF2R mRNA CTD PMID:19770486 and PMID:23142538 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine increases methylation ISO Igf2r (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased methylation of IGF2R gene CTD PMID:23142538 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Igf2r (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of IGF2R mRNA CTD PMID:23142538 and PMID:33956508 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Igf2r (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IGF2R mRNA CTD PMID:21570461 Igf2r Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of IGF2R mRNA CTD PMID:22298810 Igf2r Rat 2,4,6-tribromophenol increases expression ISO IGF2R (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Igf2r Rat 2-methylcholine affects expression ISO IGF2R (Homo sapiens) 6480464 beta-methylcholine affects the expression of IGF2R mRNA CTD PMID:21179406 Igf2r Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Igf2r Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO IGF2R (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of IGF2R protein CTD PMID:31675489 Igf2r Rat 3,4-methylenedioxymethamphetamine increases expression ISO Igf2r (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of IGF2R mRNA CTD PMID:20188158 Igf2r Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of IGF2R mRNA CTD PMID:19162173 Igf2r Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of IGF2R mRNA CTD PMID:25380136 Igf2r Rat 4,4'-sulfonyldiphenol increases expression ISO Igf2r (Mus musculus) 6480464 bisphenol S results in increased expression of IGF2R mRNA CTD PMID:30951980 Igf2r Rat 4,4'-sulfonyldiphenol decreases methylation ISO IGF2R (Homo sapiens) 6480464 bisphenol S results in decreased methylation of IGF2R gene CTD PMID:31601247 Igf2r Rat 4,4'-sulfonyldiphenol increases methylation ISO Igf2r (Mus musculus) 6480464 bisphenol S results in increased methylation of IGF2R exon CTD PMID:33297965 Igf2r Rat 4,4'-sulfonyldiphenol decreases expression ISO Igf2r (Mus musculus) 6480464 bisphenol S results in decreased expression of IGF2R mRNA CTD PMID:39298647 Igf2r Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of IGF2R mRNA CTD PMID:30047161 Igf2r Rat acetylsalicylic acid increases expression ISO IGF2R (Homo sapiens) 6480464 Aspirin results in increased expression of IGF2R mRNA CTD PMID:15928584 Igf2r Rat acrolein multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of IGF2R mRNA CTD PMID:32845096 Igf2r Rat acrylamide increases expression ISO IGF2R (Homo sapiens) 6480464 Acrylamide results in increased expression of IGF2R mRNA CTD PMID:32763439 Igf2r Rat aflatoxin B1 increases expression ISO Igf2r (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of IGF2R mRNA CTD PMID:19770486 Igf2r Rat aflatoxin B1 increases methylation ISO IGF2R (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of IGF2R gene and Aflatoxin B1 results in increased methylation of IGF2R intron CTD PMID:27153756 and PMID:30157460 Igf2r Rat Aflatoxin B2 alpha decreases methylation ISO IGF2R (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of IGF2R intron CTD PMID:30157460 Igf2r Rat aldehydo-D-glucose multiple interactions EXP 6480464 [Glucose co-treated with IGF2R protein modified form] results in decreased expression of IL6 protein more ... CTD PMID:36462176 Igf2r Rat all-trans-retinoic acid multiple interactions ISO IGF2R (Homo sapiens) 6480464 Tretinoin promotes the reaction [IGF2R binds to and results in increased secretion of IGF2 protein modified form] CTD PMID:16680587 Igf2r Rat all-trans-retinoic acid increases expression ISO IGF2R (Homo sapiens) 6480464 Tretinoin results in increased expression of IGF2R mRNA CTD PMID:33167477 Igf2r Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of IGF2R protein CTD PMID:21433279 Igf2r Rat all-trans-retinoic acid multiple interactions EXP 6480464 Tretinoin inhibits the reaction [nitrofen results in decreased expression of IGF2R mRNA] CTD PMID:21433279 Igf2r Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of IGF2R mRNA CTD PMID:30047161 Igf2r Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IGF2R mRNA CTD PMID:16483693 Igf2r Rat arsane increases response to substance ISO IGF2R (Homo sapiens) 6480464 IGF2R mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Igf2r Rat arsane affects expression ISO IGF2R (Homo sapiens) 6480464 Arsenic affects the expression of IGF2R mRNA CTD PMID:28793237 Igf2r Rat arsenic atom increases response to substance ISO IGF2R (Homo sapiens) 6480464 IGF2R mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Igf2r Rat arsenic atom affects expression ISO IGF2R (Homo sapiens) 6480464 Arsenic affects the expression of IGF2R mRNA CTD PMID:28793237 Igf2r Rat arsenite(3-) affects expression ISO IGF2R (Homo sapiens) 6480464 arsenite affects the expression of IGF2R mRNA CTD PMID:22959463 Igf2r Rat arsenite(3-) multiple interactions ISO IGF2R (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to IGF2R mRNA] CTD PMID:32406909 Igf2r Rat arsenous acid decreases expression ISO IGF2R (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IGF2R protein CTD PMID:25419056 Igf2r Rat atrazine decreases expression ISO IGF2R (Homo sapiens) 6480464 Atrazine results in decreased expression of IGF2R mRNA CTD PMID:22378314 Igf2r Rat azoxystrobin decreases expression ISO IGF2R (Homo sapiens) 6480464 azoxystrobin results in decreased expression of IGF2R mRNA CTD PMID:33512557 Igf2r Rat benzo[a]pyrene decreases expression ISO IGF2R (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of IGF2R mRNA CTD PMID:20064835 Igf2r Rat benzo[a]pyrene affects methylation ISO IGF2R (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IGF2R intron CTD PMID:30157460 Igf2r Rat benzo[a]pyrene decreases methylation ISO Igf2r (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of IGF2R exon and Benzo(a)pyrene results in decreased methylation of IGF2R intron CTD PMID:27901495 Igf2r Rat benzo[a]pyrene increases methylation ISO IGF2R (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of IGF2R promoter CTD PMID:27901495 Igf2r Rat benzo[a]pyrene increases expression ISO Igf2r (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of IGF2R mRNA CTD PMID:22228805 Igf2r Rat benzo[a]pyrene decreases expression ISO Igf2r (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of IGF2R mRNA CTD PMID:19770486 Igf2r Rat benzo[b]fluoranthene increases expression ISO Igf2r (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of IGF2R mRNA CTD PMID:26377693 Igf2r Rat bis(2-ethylhexyl) phthalate affects expression ISO Igf2r (Mus musculus) 6480464 Diethylhexyl Phthalate affects the expression of IGF2R mRNA CTD PMID:21636974 Igf2r Rat bis(2-ethylhexyl) phthalate decreases expression ISO Igf2r (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of IGF2R mRNA CTD PMID:34319233 Igf2r Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Igf2r (Mus musculus) 6480464 [Diethylhexyl Phthalate results in decreased methylation of IGF2R promoter] which results in increased expression of IGF2R mRNA CTD PMID:33424850 Igf2r Rat bis(2-ethylhexyl) phthalate affects methylation ISO Igf2r (Mus musculus) 6480464 Diethylhexyl Phthalate affects the methylation of IGF2R gene CTD PMID:38833407 Igf2r Rat bis(2-ethylhexyl) phthalate decreases methylation ISO IGF2R (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased methylation of IGF2R promoter CTD PMID:33424850 Igf2r Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat bisphenol A multiple interactions ISO Igf2r (Mus musculus) 6480464 fulvestrant inhibits the reaction [bisphenol A results in decreased methylation of IGF2R gene] CTD PMID:22131059 Igf2r Rat bisphenol A increases expression ISO Igf2r (Mus musculus) 6480464 bisphenol A results in increased expression of IGF2R mRNA CTD PMID:32353937 Igf2r Rat bisphenol A decreases expression ISO IGF2R (Homo sapiens) 6480464 bisphenol A results in decreased expression of IGF2R protein CTD PMID:31675489 Igf2r Rat bisphenol A increases methylation ISO IGF2R (Homo sapiens) 6480464 bisphenol A results in increased methylation of IGF2R gene CTD PMID:32645488 Igf2r Rat bisphenol A affects expression ISO IGF2R (Homo sapiens) 6480464 bisphenol A affects the expression of IGF2R mRNA CTD PMID:30903817 Igf2r Rat bisphenol A increases expression ISO IGF2R (Homo sapiens) 6480464 bisphenol A results in increased expression of IGF2R mRNA and bisphenol A results in increased expression of IGF2R protein CTD PMID:29275510 more ... Igf2r Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IGF2R mRNA CTD PMID:25181051 Igf2r Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of IGF2R mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of IGF2R mRNA CTD PMID:25607892 and PMID:26496021 Igf2r Rat bisphenol A decreases methylation ISO Igf2r (Mus musculus) 6480464 bisphenol A results in decreased methylation of IGF2R gene CTD PMID:22131059 and PMID:22699882 Igf2r Rat bisphenol AF increases expression ISO IGF2R (Homo sapiens) 6480464 bisphenol AF results in increased expression of IGF2R protein CTD PMID:34186270 Igf2r Rat Bisphenol B increases expression ISO IGF2R (Homo sapiens) 6480464 bisphenol B results in increased expression of IGF2R protein CTD PMID:34186270 Igf2r Rat bisphenol F increases expression ISO Igf2r (Mus musculus) 6480464 bisphenol F results in increased expression of IGF2R mRNA CTD PMID:30951980 Igf2r Rat bisphenol F decreases expression ISO Igf2r (Mus musculus) 6480464 bisphenol F results in decreased expression of IGF2R mRNA CTD PMID:38685157 Igf2r Rat bisphenol F increases expression ISO IGF2R (Homo sapiens) 6480464 bisphenol F results in increased expression of IGF2R protein CTD PMID:34186270 Igf2r Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of IGF2R mRNA CTD PMID:17327699 Igf2r Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of IGF2R mRNA CTD PMID:17327699 Igf2r Rat cadmium dichloride increases expression ISO IGF2R (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of IGF2R mRNA CTD PMID:38568856 Igf2r Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of IGF2R mRNA CTD PMID:19010381 Igf2r Rat caffeine affects phosphorylation ISO IGF2R (Homo sapiens) 6480464 Caffeine affects the phosphorylation of IGF2R protein CTD PMID:35688186 Igf2r Rat carbamazepine affects expression ISO IGF2R (Homo sapiens) 6480464 Carbamazepine affects the expression of IGF2R mRNA CTD PMID:25979313 Igf2r Rat carbon nanotube decreases expression ISO Igf2r (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of IGF2R mRNA CTD PMID:25620056 Igf2r Rat carboplatin decreases expression EXP 6480464 Carboplatin results in decreased expression of IGF2R mRNA CTD PMID:18172885 Igf2r Rat chloroacetaldehyde affects expression ISO IGF2R (Homo sapiens) 6480464 chloroacetaldehyde affects the expression of IGF2R mRNA CTD PMID:25596134 Igf2r Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of IGF2R mRNA CTD PMID:18668222 Igf2r Rat chlorpyrifos increases expression ISO Igf2r (Mus musculus) 6480464 Chlorpyrifos results in increased expression of IGF2R mRNA CTD PMID:37019170 Igf2r Rat cholesterol multiple interactions EXP 6480464 [IGF2R protein alternative form results in increased susceptibility to Streptozocin] which results in increased abundance of Cholesterol CTD PMID:35993117 Igf2r Rat cidofovir anhydrous affects expression ISO IGF2R (Homo sapiens) 6480464 Cidofovir affects the expression of IGF2R mRNA CTD PMID:25596134 Igf2r Rat cobalt dichloride increases expression ISO IGF2R (Homo sapiens) 6480464 cobaltous chloride results in increased expression of IGF2R mRNA CTD PMID:19320972 Igf2r Rat copper atom multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of IGF2R mRNA and [NSC 689534 binds to Copper] which results in increased expression of IGF2R mRNA CTD PMID:20971185 and PMID:24690739 Igf2r Rat copper(0) multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of IGF2R mRNA and [NSC 689534 binds to Copper] which results in increased expression of IGF2R mRNA CTD PMID:20971185 and PMID:24690739 Igf2r Rat copper(II) sulfate increases expression ISO IGF2R (Homo sapiens) 6480464 Copper Sulfate results in increased expression of IGF2R mRNA CTD PMID:19549813 Igf2r Rat corticosterone multiple interactions EXP 6480464 [IGF2R protein co-treated with IGF1R protein] affects the reaction [IGF2 protein inhibits the reaction [Corticosterone results in decreased expression of SOD2 protein]] CTD PMID:24667322 Igf2r Rat cyclosporin A increases expression ISO IGF2R (Homo sapiens) 6480464 Cyclosporine results in increased expression of IGF2R mRNA CTD PMID:20106945 and PMID:25596134 Igf2r Rat cyclosporin A decreases expression ISO IGF2R (Homo sapiens) 6480464 Cyclosporine results in decreased expression of IGF2R mRNA CTD PMID:25562108 Igf2r Rat D-glucose multiple interactions EXP 6480464 [Glucose co-treated with IGF2R protein modified form] results in decreased expression of IL6 protein more ... CTD PMID:36462176 Igf2r Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat dextran sulfate multiple interactions ISO Igf2r (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of IGF2R protein] CTD PMID:35362542 Igf2r Rat dextran sulfate increases expression ISO Igf2r (Mus musculus) 6480464 Dextran Sulfate results in increased expression of IGF2R protein CTD PMID:35362542 Igf2r Rat diarsenic trioxide decreases expression ISO IGF2R (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IGF2R protein CTD PMID:25419056 Igf2r Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat diclofenac multiple interactions ISO Igf2r (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of IGF2R mRNA CTD PMID:37844793 Igf2r Rat dicrotophos increases expression ISO IGF2R (Homo sapiens) 6480464 dicrotophos results in increased expression of IGF2R mRNA CTD PMID:28302478 Igf2r Rat disulfiram multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of IGF2R mRNA CTD PMID:24690739 Igf2r Rat dorsomorphin multiple interactions ISO IGF2R (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2R mRNA CTD PMID:27188386 Igf2r Rat doxorubicin decreases expression ISO Igf2r (Mus musculus) 6480464 Doxorubicin results in decreased expression of IGF2R protein CTD PMID:30517846 Igf2r Rat doxorubicin increases expression ISO IGF2R (Homo sapiens) 6480464 Doxorubicin results in increased expression of IGF2R mRNA CTD PMID:29803840 Igf2r Rat elemental selenium decreases expression ISO IGF2R (Homo sapiens) 6480464 Selenium results in decreased expression of IGF2R mRNA CTD PMID:19244175 Igf2r Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in decreased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat enzyme inhibitor multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of IGF2R protein CTD PMID:23301498 Igf2r Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat erythromycin estolate increases expression EXP 6480464 Erythromycin Estolate results in increased expression of IGF2R mRNA CTD PMID:24412560 Igf2r Rat ethanol increases expression ISO Igf2r (Mus musculus) 6480464 Ethanol results in increased expression of IGF2R mRNA CTD PMID:30319688 Igf2r Rat Evodiamine multiple interactions ISO Igf2r (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of IGF2R protein] CTD PMID:35362542 Igf2r Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of IGF2R mRNA CTD PMID:25596134 Igf2r Rat fenthion decreases expression ISO Igf2r (Mus musculus) 6480464 Fenthion results in decreased expression of IGF2R mRNA CTD PMID:34813904 Igf2r Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of IGF2R mRNA CTD PMID:24136188 Igf2r Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of IGF2R mRNA CTD PMID:31881178 and PMID:34044035 Igf2r Rat folic acid increases methylation ISO Igf2r (Mus musculus) 6480464 Folic Acid results in increased methylation of IGF2R mRNA CTD PMID:22959928 Igf2r Rat folic acid decreases expression ISO IGF2R (Homo sapiens) 6480464 Folic Acid results in decreased expression of IGF2R mRNA CTD PMID:21867686 Igf2r Rat folic acid multiple interactions ISO Igf2r (Mus musculus) 6480464 [1 more ... CTD PMID:22206623 and PMID:22959928 Igf2r Rat FR900359 decreases phosphorylation ISO IGF2R (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of IGF2R protein CTD PMID:37730182 Igf2r Rat fulvestrant multiple interactions ISO Igf2r (Mus musculus) 6480464 fulvestrant inhibits the reaction [bisphenol A results in decreased methylation of IGF2R gene] CTD PMID:22131059 Igf2r Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [dan-shen root extract inhibits the reaction [IGF2 protein mutant form results in increased expression of IGF2R protein]] CTD PMID:23419388 Igf2r Rat genistein increases expression ISO IGF2R (Homo sapiens) 6480464 Genistein results in increased expression of IGF2R mRNA CTD PMID:22228119 Igf2r Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of IGF2R mRNA CTD PMID:33387578 Igf2r Rat glucose multiple interactions EXP 6480464 [Glucose co-treated with IGF2R protein modified form] results in decreased expression of IL6 protein more ... CTD PMID:36462176 Igf2r Rat ibuprofen multiple interactions ISO Igf2r (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of IGF2R mRNA CTD PMID:37844793 Igf2r Rat ifosfamide increases expression ISO IGF2R (Homo sapiens) 6480464 Ifosfamide results in increased expression of IGF2R mRNA CTD PMID:25596134 Igf2r Rat inulin multiple interactions ISO Igf2r (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of IGF2R mRNA CTD PMID:36331819 Igf2r Rat ivermectin decreases expression ISO IGF2R (Homo sapiens) 6480464 Ivermectin results in decreased expression of IGF2R protein CTD PMID:32959892 Igf2r Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of IGF2R mRNA CTD PMID:18544905 Igf2r Rat lead(0) decreases methylation ISO Igf2r (Mus musculus) 6480464 Lead results in decreased methylation of IGF2R gene CTD PMID:38833407 Igf2r Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of IGF2R protein CTD PMID:31714667 Igf2r Rat lipopolysaccharide multiple interactions EXP 6480464 Honghua extract and Carthamus tinctorius inhibits the reaction [Lipopolysaccharides results in increased expression of IGF2R protein] CTD PMID:31714667 Igf2r Rat manganese atom multiple interactions ISO IGF2R (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGF2R mRNA CTD PMID:39836092 Igf2r Rat manganese(0) multiple interactions ISO IGF2R (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGF2R mRNA CTD PMID:39836092 Igf2r Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of IGF2R mRNA CTD PMID:19276553 Igf2r Rat manganese(II) chloride multiple interactions ISO IGF2R (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGF2R mRNA CTD PMID:39836092 Igf2r Rat menadione affects expression ISO IGF2R (Homo sapiens) 6480464 Vitamin K 3 affects the expression of IGF2R mRNA CTD PMID:20044591 Igf2r Rat metformin multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Metformin co-treated with IGF1 protein] results in decreased expression of IGF2R mRNA more ... CTD PMID:21664031 Igf2r Rat metformin increases expression EXP 6480464 Metformin results in increased expression of IGF2R mRNA CTD PMID:25596134 Igf2r Rat methidathion decreases expression ISO Igf2r (Mus musculus) 6480464 methidathion results in decreased expression of IGF2R mRNA CTD PMID:34813904 Igf2r Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of IGF2R mRNA CTD PMID:30047161 Igf2r Rat N-methyl-4-phenylpyridinium affects expression ISO IGF2R (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of IGF2R mRNA CTD PMID:12710931 Igf2r Rat N-nitrosodiethylamine multiple interactions ISO Igf2r (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Gasoline] results in decreased expression of IGF2R protein more ... CTD PMID:24535843 and PMID:8824503 Igf2r Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of IGF2R mRNA CTD PMID:19542621 Igf2r Rat N-nitrosodiethylamine increases mutagenesis EXP 6480464 Diethylnitrosamine deficiency results in increased mutagenesis of IGF2R gene and Diethylnitrosamine results in increased mutagenesis of IGF2R gene CTD PMID:15057872 Igf2r Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of IGF2R mRNA CTD PMID:18544905 Igf2r Rat N-nitrosodiethylamine decreases expression ISO Igf2r (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of IGF2R protein CTD PMID:8824503 Igf2r Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of IGF2R mRNA and nitrofen results in decreased expression of IGF2R protein CTD PMID:20620343 and PMID:21433279 Igf2r Rat nitrofen multiple interactions EXP 6480464 Tretinoin inhibits the reaction [nitrofen results in decreased expression of IGF2R mRNA] CTD PMID:21433279 Igf2r Rat ozone multiple interactions ISO IGF2R (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of IGF2R mRNA CTD PMID:32845096 Igf2r Rat p-menthan-3-ol increases expression ISO IGF2R (Homo sapiens) 6480464 Menthol results in increased expression of IGF2R mRNA CTD PMID:26760959 Igf2r Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of IGF2R mRNA CTD PMID:27638505 Igf2r Rat paracetamol affects expression ISO Igf2r (Mus musculus) 6480464 Acetaminophen affects the expression of IGF2R mRNA CTD PMID:17562736 Igf2r Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of IGF2R mRNA CTD PMID:33387578 Igf2r Rat paracetamol decreases expression ISO IGF2R (Homo sapiens) 6480464 Acetaminophen results in decreased expression of IGF2R mRNA CTD PMID:21420995 Igf2r Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of IGF2R mRNA CTD PMID:16328009 Igf2r Rat perfluorooctane-1-sulfonic acid decreases expression ISO Igf2r (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of IGF2R protein CTD PMID:26178269 Igf2r Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Igf2r (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IGF2R mRNA more ... CTD PMID:36331819 Igf2r Rat perfluorooctanoic acid increases expression ISO IGF2R (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of IGF2R mRNA CTD PMID:35548680 Igf2r Rat phenobarbital increases expression ISO Igf2r (Mus musculus) 6480464 Phenobarbital results in increased expression of IGF2R mRNA CTD PMID:19482888 Igf2r Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of IGF2R mRNA and Phenobarbital results in increased expression of IGF2R protein CTD PMID:8055622 Igf2r Rat phenobarbital multiple interactions ISO Igf2r (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of IGF2R mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of IGF2R mRNA] CTD PMID:19482888 and PMID:24535843 Igf2r Rat phenylmercury acetate increases expression ISO IGF2R (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of IGF2R mRNA CTD PMID:26272509 Igf2r Rat phenylmercury acetate multiple interactions ISO IGF2R (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2R mRNA CTD PMID:27188386 Igf2r Rat picoxystrobin decreases expression ISO IGF2R (Homo sapiens) 6480464 picoxystrobin results in decreased expression of IGF2R mRNA CTD PMID:33512557 Igf2r Rat pirinixic acid multiple interactions ISO Igf2r (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of IGF2R mRNA CTD PMID:19710929 Igf2r Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of IGF2R mRNA CTD PMID:19162173 Igf2r Rat pirinixic acid decreases expression ISO Igf2r (Mus musculus) 6480464 pirinixic acid results in decreased expression of IGF2R mRNA CTD PMID:18445702 Igf2r Rat pirinixic acid increases expression ISO Igf2r (Mus musculus) 6480464 pirinixic acid results in increased expression of IGF2R mRNA CTD PMID:17426115 Igf2r Rat poly(I:C) multiple interactions ISO IGF2R (Homo sapiens) 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of IGF2R mRNA CTD PMID:35688559 Igf2r Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat resveratrol increases expression ISO IGF2R (Homo sapiens) 6480464 resveratrol results in increased expression of IGF2R mRNA CTD PMID:12002526 Igf2r Rat rotenone decreases expression ISO IGF2R (Homo sapiens) 6480464 Rotenone results in decreased expression of IGF2R mRNA CTD PMID:33512557 Igf2r Rat Salinomycin decreases expression ISO IGF2R (Homo sapiens) 6480464 salinomycin results in decreased expression of IGF2R mRNA CTD PMID:19682730 Igf2r Rat SB 431542 multiple interactions ISO IGF2R (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2R mRNA CTD PMID:27188386 Igf2r Rat selenium atom decreases expression ISO IGF2R (Homo sapiens) 6480464 Selenium results in decreased expression of IGF2R mRNA CTD PMID:19244175 Igf2r Rat sodium arsenate decreases expression ISO Igf2r (Mus musculus) 6480464 sodium arsenate results in decreased expression of IGF2R mRNA CTD PMID:21795629 and PMID:30953684 Igf2r Rat sodium arsenate increases expression ISO Igf2r (Mus musculus) 6480464 sodium arsenate results in increased expression of IGF2R mRNA CTD PMID:21795629 Igf2r Rat sodium arsenite affects expression ISO IGF2R (Homo sapiens) 6480464 sodium arsenite affects the expression of IGF2R mRNA CTD PMID:20816728 Igf2r Rat sodium arsenite increases expression ISO IGF2R (Homo sapiens) 6480464 sodium arsenite results in increased expression of IGF2R mRNA CTD PMID:38568856 Igf2r Rat sodium arsenite increases expression ISO Igf2r (Mus musculus) 6480464 sodium arsenite results in increased expression of IGF2R mRNA CTD PMID:17077188 more ... Igf2r Rat sodium arsenite decreases expression ISO Igf2r (Mus musculus) 6480464 sodium arsenite results in decreased expression of IGF2R mRNA CTD PMID:19822182 Igf2r Rat sodium arsenite multiple interactions ISO Igf2r (Mus musculus) 6480464 [Folic Acid co-treated with sodium arsenite] results in increased methylation of IGF2R mRNA CTD PMID:22959928 Igf2r Rat sodium dodecyl sulfate increases expression ISO IGF2R (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of IGF2R mRNA CTD PMID:31734321 Igf2r Rat streptozocin multiple interactions EXP 6480464 [IGF2R protein alternative form results in increased susceptibility to Streptozocin] which results in increased abundance of Cholesterol more ... CTD PMID:35993117 and PMID:36462176 Igf2r Rat streptozocin increases response to substance EXP 6480464 IGF2R protein alternative form results in increased susceptibility to Streptozocin CTD PMID:35993117 Igf2r Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of IGF2R protein CTD PMID:36462176 Igf2r Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of IGF2R mRNA CTD PMID:30047161 Igf2r Rat sulforaphane increases expression ISO IGF2R (Homo sapiens) 6480464 sulforaphane results in increased expression of IGF2R mRNA CTD PMID:31838189 Igf2r Rat sunitinib increases expression ISO IGF2R (Homo sapiens) 6480464 Sunitinib results in increased expression of IGF2R mRNA CTD PMID:31533062 Igf2r Rat Tanshinone I multiple interactions EXP 6480464 [IGF2 protein mutant form co-treated with tanshinone] results in decreased expression of IGF2R protein CTD PMID:34655285 Igf2r Rat Tanshinone I decreases expression EXP 6480464 tanshinone results in decreased expression of IGF2R protein CTD PMID:34655285 Igf2r Rat temozolomide decreases expression ISO IGF2R (Homo sapiens) 6480464 Temozolomide results in decreased expression of IGF2R mRNA CTD PMID:31758290 Igf2r Rat testosterone enanthate increases expression EXP 6480464 testosterone enanthate results in increased expression of IGF2R mRNA CTD PMID:23085480 Igf2r Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of IGF2R mRNA CTD PMID:15963342 Igf2r Rat tetrachloromethane decreases expression ISO Igf2r (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of IGF2R mRNA CTD PMID:31919559 Igf2r Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of IGF2R mRNA CTD PMID:23411599 and PMID:34492290 Igf2r Rat titanium dioxide decreases methylation ISO Igf2r (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IGF2R gene and titanium dioxide results in decreased methylation of IGF2R promoter CTD PMID:35295148 Igf2r Rat Tributyltin oxide increases expression EXP 6480464 bis(tri-n-butyltin)oxide results in increased expression of IGF2R mRNA CTD PMID:17553608 Igf2r Rat Tributyltin oxide decreases phosphorylation ISO Igf2r (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of IGF2R protein CTD PMID:22174045 Igf2r Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of IGF2R mRNA CTD PMID:33387578 Igf2r Rat trichostatin A affects expression ISO IGF2R (Homo sapiens) 6480464 trichostatin A affects the expression of IGF2R mRNA CTD PMID:28542535 Igf2r Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of IGF2R mRNA CTD PMID:30589522 Igf2r Rat triphenyl phosphate increases expression ISO Igf2r (Mus musculus) 6480464 triphenyl phosphate results in increased expression of IGF2R mRNA CTD PMID:29316351 Igf2r Rat triptonide decreases expression ISO Igf2r (Mus musculus) 6480464 triptonide results in decreased expression of IGF2R mRNA CTD PMID:33045310 Igf2r Rat tungsten decreases expression ISO Igf2r (Mus musculus) 6480464 Tungsten results in decreased expression of IGF2R mRNA CTD PMID:30912803 Igf2r Rat tunicamycin decreases expression ISO Igf2r (Mus musculus) 6480464 Tunicamycin results in decreased expression of IGF2R mRNA CTD PMID:17127020 Igf2r Rat tunicamycin increases expression ISO Igf2r (Mus musculus) 6480464 Tunicamycin results in increased expression of IGF2R mRNA CTD PMID:17127020 Igf2r Rat urethane increases expression ISO IGF2R (Homo sapiens) 6480464 Urethane results in increased expression of IGF2R mRNA CTD PMID:28818685 Igf2r Rat valproic acid affects expression ISO Igf2r (Mus musculus) 6480464 Valproic Acid affects the expression of IGF2R mRNA CTD PMID:17292431 and PMID:17963808 Igf2r Rat valproic acid affects expression ISO IGF2R (Homo sapiens) 6480464 Valproic Acid affects the expression of IGF2R mRNA CTD PMID:25979313 Igf2r Rat valproic acid increases expression ISO IGF2R (Homo sapiens) 6480464 Valproic Acid results in increased expression of IGF2R mRNA and Valproic Acid results in increased expression of IGF2R protein CTD PMID:19101580 more ... Igf2r Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of IGF2R mRNA CTD PMID:25607892 Igf2r Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of IGF2R mRNA CTD PMID:23034163 Igf2r Rat vitamin E decreases expression ISO IGF2R (Homo sapiens) 6480464 Vitamin E results in decreased expression of IGF2R mRNA CTD PMID:19244175
(1->4)-beta-D-glucan (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Butylparaben (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) carboplatin (EXP) chloroacetaldehyde (ISO) chlorpyrifos (EXP,ISO) cholesterol (EXP) cidofovir anhydrous (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corticosterone (EXP) cyclosporin A (ISO) D-glucose (EXP) DDE (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) diclofenac (ISO) dicrotophos (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) enzacamene (EXP) enzyme inhibitor (ISO) epoxiconazole (EXP) erythromycin estolate (EXP) ethanol (ISO) Evodiamine (ISO) fenofibrate (EXP) fenthion (ISO) finasteride (EXP) fipronil (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (EXP,ISO) genistein (ISO) gentamycin (EXP) glucose (EXP) ibuprofen (ISO) ifosfamide (ISO) inulin (ISO) ivermectin (ISO) kojic acid (EXP) lead(0) (ISO) linuron (EXP) lipopolysaccharide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP,ISO) menadione (ISO) metformin (EXP,ISO) methidathion (ISO) methimazole (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) nitrofen (EXP) ozone (ISO) p-menthan-3-ol (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) picoxystrobin (ISO) pirinixic acid (EXP,ISO) poly(I:C) (ISO) prochloraz (EXP) procymidone (EXP) resveratrol (ISO) rotenone (ISO) Salinomycin (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) Tanshinone I (EXP) temozolomide (ISO) testosterone enanthate (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) Tributyltin oxide (EXP,ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Cellular Component
cell surface (IEA,ISO) clathrin coat (IDA) early endosome (IEA,ISO) endocytic vesicle (IEA,ISO) endomembrane system (IEA) endosome (IDA,IEA,ISO) endosome membrane (IEA,ISO) extracellular space (IDA) Golgi apparatus (IEA,ISO) Golgi membrane (IEA) intracellular membrane-bounded organelle (IEA) late endosome (IBA,IDA,IEA,ISO) membrane (IEA,ISO) nuclear envelope lumen (IEA,ISO) nucleus (IEA,ISO) perinuclear region of cytoplasm (IDA) plasma membrane (IBA) trans-Golgi network (IBA,IDA,IEA,ISO) trans-Golgi network transport vesicle (IEA,ISO)
1.
Changes in distribution of phosphomannosyl receptors during maturation of rat spermatozoa.
Belmonte SA, etal., Biol Reprod. 2000 Oct;63(4):1172-8.
2.
Activation of insulin-like growth factor II receptor induces mitochondrial-dependent apoptosis through G(alpha)q and downstream calcineurin signaling in myocardial cells.
Chu CH, etal., Endocrinology. 2009 Jun;150(6):2723-31. Epub 2008 Dec 18.
3.
A highly phosphorylated subpopulation of insulin-like growth factor II/mannose 6-phosphate receptors is concentrated in a clathrin-enriched plasma membrane fraction.
Corvera S, etal., Proc Natl Acad Sci U S A. 1988 Oct;85(20):7567-71.
4.
Up-regulation of insulin-like growth factor-II receptor in reactive astrocytes in the spinal cord of amyotrophic lateral sclerosis transgenic rats.
Dagvajantsan B, etal., Tohoku J Exp Med. 2008 Apr;214(4):303-10.
5.
M6P/IGF2R gene is mutated in human hepatocellular carcinomas with loss of heterozygosity.
De Souza AT, etal., Nat Genet. 1995 Dec;11(4):447-9.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
M6P/IGF2 receptor: a candidate breast tumor suppressor gene.
Hankins GR, etal., Oncogene. 1996 May 2;12(9):2003-9.
9.
Insulin-like growth factor-II/mannose-6-phosphate receptor: widespread distribution in neurons of the central nervous system including those expressing cholinergic phenotype.
Hawkes C and Kar S, J Comp Neurol 2003 Mar 31;458(2):113-27.
10.
Single transmembrane domain insulin-like growth factor-II/mannose-6-phosphate receptor regulates central cholinergic function by activating a G-protein-sensitive, protein kinase C-dependent pathway.
Hawkes C, etal., J Neurosci. 2006 Jan 11;26(2):585-96.
11.
3-Methyladenine specifically inhibits retrograde transport of cation-independent mannose 6-phosphate/insulin-like growth factor II receptor from the early endosome to the TGN.
Hirosako K, etal., Biochem Biophys Res Commun. 2004 Apr 9;316(3):845-52.
12.
Clinical significance of loss of heterozygosity for M6P/IGF2R in patients with primary hepatocellular carcinoma.
Jang HS, etal., World J Gastroenterol. 2008 Mar 7;14(9):1394-8. doi: 10.3748/wjg.14.1394.
13.
Organ-specific changes in the expression of mannose-6-phosphate receptors during postnatal development in rats.
Jofre GF, etal., Cells Tissues Organs. 2009;190(1):27-33. Epub 2008 Sep 30.
14.
Mannose 6-phosphate/insulin-like growth factor II receptor mediates the growth-inhibitory effects of retinoids.
Kang JX, etal., Cell Growth Differ. 1999 Aug;10(8):591-600.
15.
Retinoic acid alters the intracellular trafficking of the mannose-6-phosphate/insulin-like growth factor II receptor and lysosomal enzymes.
Kang JX, etal., Proc Natl Acad Sci U S A. 1998 Nov 10;95(23):13687-91.
16.
Loss of the imprinted IGF2/cation-independent mannose 6-phosphate receptor results in fetal overgrowth and perinatal lethality.
Lau MM, etal., Genes Dev 1994 Dec 15;8(24):2953-63.
17.
Expression and prognostic significance of insulin‑like growth factor-2 receptor in human hepatocellular carcinoma and the influence of transarterial chemoembolization.
Lautem A, etal., Oncol Rep. 2019 Apr;41(4):2299-2310. doi: 10.3892/or.2019.6995. Epub 2019 Feb 1.
18.
Roles of insulin-like growth factor II in cardiomyoblast apoptosis and in hypertensive rat heart with abdominal aorta ligation.
Lee SD, etal., Am J Physiol Endocrinol Metab. 2006 Aug;291(2):E306-14.
19.
A single receptor binds both insulin-like growth factor II and mannose-6-phosphate.
MacDonald RG, etal., Science 1988 Mar 4;239(4844):1134-7.
20.
The insulin-like growth factor-II receptor gene is associated with type 1 diabetes: evidence of a maternal effect.
McCann JA, etal., J Clin Endocrinol Metab. 2004 Nov;89(11):5700-6.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Imprinted M6p/Igf2 receptor is mutated in rat liver tumors.
Mills JJ, etal., Oncogene. 1998 May 28;16(21):2797-802.
23.
In vitro reconstitution of fusion between immature autophagosomes and endosomes.
Morvan J, etal., Autophagy. 2009 Jul;5(5):676-89. Epub 2009 Jul 6.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
Renin/prorenin receptors.
Nguyen G, Kidney Int. 2006 May;69(9):1503-6.
26.
M6P/IGF2R tumor suppressor gene mutated in hepatocellular carcinomas in Japan.
Oka Y, etal., Hepatology. 2002 May;35(5):1153-63. doi: 10.1053/jhep.2002.32669.
27.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
28.
Changes in IGF-I and -II, IGF binding protein, and IGF receptor transcript abundance after uterine artery ligation.
Price WA, etal., Pediatr Res. 1992 Sep;32(3):291-5. doi: 10.1203/00006450-199209000-00009.
29.
GOA pipeline
RGD automated data pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Expression and binding properties of the two mannose-6-phosphate receptors differ during perinatal development in rat liver.
Romano PS, etal., Biochem Biophys Res Commun. 2002 Jul 26;295(4):1000-6.
33.
Changes in the mRNA expressions of insulin-like growth factors, their receptors, and binding proteins during the postnatal development of rat masseter muscle.
Saito T, etal., Zoolog Sci 2003 Apr;20(4):441-7.
34.
High-affinity prorenin binding to cardiac man-6-P/IGF-II receptors precedes proteolytic activation to renin.
Saris JJ, etal., Am J Physiol Heart Circ Physiol. 2001 Apr;280(4):H1706-15.
35.
Mutations in the IGF-II pathway that confer resistance to lytic reovirus infection.
Sheng J, etal., BMC Cell Biol. 2004 Aug 27;5:32.
36.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
37.
Alterations of the M6p/Igf2 receptor gene in lung adenocarcinomas induced by N-nitrosobis(2-hydroxypropyl)amine in rats.
Tsujiuchi T, etal., Mol Carcinog 2003 Jan;36(1):32-7.
38.
Alterations of the M6p/Igf2 receptor gene in hepatocellular carcinomas induced by N-nitrosodiethylamine and a choline-deficient L-amino acid-defined diet in rats.
Tsujiuchi T, etal., Mol Carcinog. 2004 Apr;39(4):199-205.
39.
Serum and urinary levels of CD222 in cancer: origin and diagnostic value.
Vicikova K, etal., Neoplasma. 2018 Sep 19;65(5):762-768. doi: 10.4149/neo_2018_171203N792. Epub 2018 Jun 18.
40.
The hepatocyte is a direct target for transforming-growth factor beta activation via the insulin-like growth factor II/mannose 6-phosphate receptor.
Villevalois-Cam L, etal., J Hepatol 2003 Feb;38(2):156-63.
41.
The ACAA-insertion/deletion polymorphism at the 3' UTR of the IGF-II receptor gene is associated with type 2 diabetes and surrogate markers of insulin resistance.
Villuendas G, etal., Eur J Endocrinol. 2006 Aug;155(2):331-6.
42.
Failure to detect genetic alteration of the mannose-6-phosphate/insulin-like growth factor 2 receptor (M6P/IGF2R) gene in hepatocellular carcinomas in Japan.
Wada I, etal., Hepatology. 1999 Jun;29(6):1718-21. doi: 10.1002/hep.510290635.
43.
E-box-binding repressor is down-regulated in hepatic stellate cells during up-regulation of mannose 6-phosphate/insulin-like growth factor-II receptor expression in early hepatic fibrogenesis.
Weiner JA, etal., J Biol Chem. 1998 Jun 26;273(26):15913-9. doi: 10.1074/jbc.273.26.15913.
44.
Aberrant imprinting of the insulin-like growth factor II receptor gene in Wilms' tumor.
Xu YQ, etal., Oncogene. 1997 Mar 6;14(9):1041-6.
45.
Genetic changes and expression of the mannose 6-phosphate/insulin-like growth factor II receptor gene in human hepatitis B virus-associated hepatocellular carcinoma.
Yang EB, etal., Int J Mol Med. 2003 Jun;11(6):773-8.
46.
Immunolocalization of insulin-like growth factors and their receptors in the diabetic mouse oviduct and uterine tissues during the preimplantation period.
Zakaria R, etal., Acta Histochem. 2009;111(1):52-60. Epub 2008 Aug 3.
Igf2r Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,526,878 - 50,615,265 (+) NCBI GRCr8 mRatBN7.2 1 47,979,109 - 48,067,501 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,979,109 - 48,067,501 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,670,745 - 48,759,134 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,656,245 - 54,744,657 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,746,270 - 48,834,659 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 48,176,095 - 48,264,482 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 48,176,106 - 48,264,477 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,488,767 - 51,577,141 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 42,253,273 - 42,341,646 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 42,256,217 - 42,344,589 (+) NCBI Celera 1 43,778,518 - 43,867,238 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
IGF2R Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 159,969,082 - 160,111,504 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 159,969,082 - 160,113,507 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 160,390,114 - 160,532,536 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 160,310,121 - 160,447,573 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 160,360,541 - 160,497,992 NCBI Celera 6 161,035,974 - 161,173,355 (+) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 157,860,740 - 157,998,270 (+) NCBI HuRef CHM1_1 6 160,652,348 - 160,789,828 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 161,215,266 - 161,357,599 (+) NCBI T2T-CHM13v2.0
Igf2r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 12,901,293 - 12,988,593 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 12,901,293 - 12,988,551 (-) Ensembl GRCm39 Ensembl GRCm38 17 12,682,406 - 12,769,706 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 12,682,406 - 12,769,664 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 12,875,272 - 12,962,572 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 12,525,771 - 12,613,022 (-) NCBI MGSCv36 mm8 Celera 17 12,714,412 - 12,801,753 (-) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 8.64 NCBI
Igf2r Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 20,752,855 - 20,851,281 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 20,754,915 - 20,874,759 (-) NCBI ChiLan1.0 ChiLan1.0
IGF2R Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 180,068,746 - 180,206,598 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 177,973,023 - 178,110,866 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 157,852,565 - 157,990,049 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 162,884,786 - 162,983,968 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 162,878,661 - 162,997,762 (+) Ensembl panpan1.1 panPan2
IGF2R Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 49,161,551 - 49,262,260 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 49,161,444 - 49,262,277 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 50,002,759 - 50,102,366 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 49,345,406 - 49,445,163 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 49,345,406 - 49,445,163 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 49,227,935 - 49,327,529 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 49,099,537 - 49,199,165 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 49,714,384 - 49,814,084 (+) NCBI UU_Cfam_GSD_1.0
Igf2r Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 144,195,094 - 144,271,698 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 11,447,038 - 11,524,174 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 11,447,043 - 11,523,695 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IGF2R Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 7,368,103 - 7,472,548 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 7,369,485 - 7,472,480 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 9,168,321 - 9,271,328 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IGF2R Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 87,587,717 - 87,723,795 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 87,587,907 - 87,724,116 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 59,978,473 - 60,111,795 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igf2r
.
Predicted Target Of
Count of predictions: 501 Count of miRNA genes: 256 Interacting mature miRNAs: 310 Transcripts: ENSRNOT00000021840 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
25.mHAa3f1.seq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 48,026,370 - 48,026,559 (+) MAPPER mRatBN7.2 Rnor_6.0 1 48,223,355 - 48,223,543 NCBI Rnor6.0 Rnor_5.0 1 51,529,704 - 51,529,892 UniSTS Rnor5.0 RGSC_v3.4 1 42,300,522 - 42,300,710 UniSTS RGSC3.4 Celera 1 43,826,107 - 43,826,295 UniSTS Cytogenetic Map 1 q11 UniSTS
RH128065
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 48,067,163 - 48,067,372 (+) MAPPER mRatBN7.2 Rnor_6.0 1 48,264,145 - 48,264,353 NCBI Rnor6.0 Rnor_5.0 1 51,488,893 - 51,489,101 UniSTS Rnor5.0 RGSC_v3.4 1 42,341,312 - 42,341,520 UniSTS RGSC3.4 Celera 1 43,866,901 - 43,867,109 UniSTS RH 3.4 Map 1 566.6 UniSTS Cytogenetic Map 1 q11 UniSTS
RH94626
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 48,066,393 - 48,066,568 (+) MAPPER mRatBN7.2 Rnor_6.0 1 48,263,375 - 48,263,549 NCBI Rnor6.0 Rnor_5.0 1 51,489,697 - 51,489,871 UniSTS Rnor5.0 RGSC_v3.4 1 42,340,542 - 42,340,716 UniSTS RGSC3.4 Celera 1 43,866,131 - 43,866,305 UniSTS Cytogenetic Map 1 q11 UniSTS
RH137924
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 47,996,773 - 47,997,010 (+) MAPPER mRatBN7.2 Rnor_6.0 1 48,193,759 - 48,193,995 NCBI Rnor6.0 Rnor_5.0 1 51,559,252 - 51,559,488 UniSTS Rnor5.0 RGSC_v3.4 1 42,270,926 - 42,271,162 UniSTS RGSC3.4 Celera 1 43,796,182 - 43,796,418 UniSTS RH 3.4 Map 1 564.0 UniSTS Cytogenetic Map 1 q11 UniSTS
Igf2r
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 1 51,488,890 - 51,489,008 UniSTS Rnor5.0 Cytogenetic Map 1 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021840 ⟹ ENSRNOP00000021840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,979,109 - 48,067,501 (+) Ensembl Rnor_6.0 Ensembl 1 48,176,106 - 48,264,477 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104985 ⟹ ENSRNOP00000095398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 48,000,044 - 48,067,501 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108241 ⟹ ENSRNOP00000092757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,992,461 - 48,067,501 (+) Ensembl
RefSeq Acc Id:
NM_012756 ⟹ NP_036888
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,526,878 - 50,615,265 (+) NCBI mRatBN7.2 1 47,979,109 - 48,067,501 (+) NCBI Rnor_6.0 1 48,176,095 - 48,264,482 (+) NCBI Rnor_5.0 1 51,488,767 - 51,577,141 (-) NCBI RGSC_v3.4 1 42,253,273 - 42,341,646 (+) RGD Celera 1 43,778,518 - 43,867,238 (+) NCBI
Sequence:
GCTCCCGTTGCAGCTTCGACTCCGCTGTTGCGGCGCGATCGTGTCCCAGGCGCGGCTCGGAACGGCCAGCCGCCGTGAGCCCCACGCCACACGCGATGCGGGCCGTTCTGCCGGGACCCGTGCCCTCC
hide sequence
RefSeq Acc Id:
NP_036888 ⟸ NM_012756
- Peptide Label:
precursor
- UniProtKB:
G3V824 (UniProtKB/TrEMBL), A6KJW4 (UniProtKB/TrEMBL), Q63002 (UniProtKB/TrEMBL), Q63757 (UniProtKB/TrEMBL)
- Sequence:
MRAVLPGPVPSGPRVALLLPLLLLLLVAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYKINPCGHVDNPRCGPTSAVCMCDLKSENCRSVGDSLLRSSAKSLLEFNTTTGCQPSEHRIQTSITFLCG
hide sequence
Ensembl Acc Id:
ENSRNOP00000021840 ⟸ ENSRNOT00000021840
Ensembl Acc Id:
ENSRNOP00000092757 ⟸ ENSRNOT00000108241
Ensembl Acc Id:
ENSRNOP00000095398 ⟸ ENSRNOT00000104985
RGD ID: 13689617 Promoter ID: EPDNEW_R142 Type: initiation region Name: Igf2r_1 Description: insulin-like growth factor 2 receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 48,176,088 - 48,176,148 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Igf2r
insulin-like growth factor 2 receptor
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_process
required for cytotoxic T cell-mediated apoptosis and rejection of allogeneic cells
gene_process
involved in suppression of several carcinomas
