Galr1 (galanin receptor 1) - Rat Genome Database

Name: Galr1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Galr1 (galanin receptor 1) Rattus norvegicus

Analyze

Symbol:

Galr1

Name:

galanin receptor 1

RGD ID:

2656

Description:

Enables galanin receptor activity and neuropeptide binding activity. Involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway. Predicted to be active in plasma membrane. Orthologous to human GALR1 (galanin receptor 1); INTERACTS WITH 2-deoxy-D-glucose; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GAL1-R; galanin receptor type 1; Galnr1; GALR-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GALR1 (galanin receptor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Galr1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Galr1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GALR1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GALR1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Galr1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GALR1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GALR1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Galr1 (galanin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BORA (BORA aurora kinase A activator)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GALR1 (galanin receptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Galr1 (galanin receptor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	galr1a (galanin receptor 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstA-R1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-9	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstA-R2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	galr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	78,046,803 - 78,062,359 (-)	NCBI		GRCr8
mRatBN7.2	18	75,772,021 - 75,787,577 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	75,772,023 - 75,787,577 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	77,873,305 - 77,888,899 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	78,543,582 - 78,559,170 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	76,391,102 - 76,406,704 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	79,243,009 - 79,258,570 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	79,243,009 - 79,258,570 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	78,302,017 - 78,317,578 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	78,858,892 - 78,874,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	78,941,425 - 78,947,496 (-)	NCBI
Celera	18	74,409,272 - 74,424,831 (-)	NCBI		Celera
RH 3.4 Map	18	809.9	RGD
Cytogenetic Map	18	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Burn-McKeown syndrome (ISO)

chromosome 18q deletion syndrome (ISO)

intestinal volvulus (ISO)

major depressive disorder (ISO)

morphine withdrawal syndrome (ISO)

Neurodevelopmental Disorders (ISO)

nicotine dependence (ISO)

obesity (ISO)

Oculootofacial Dysplasia (ISO)

opiate dependence (ISO)

pulmonary valve stenosis (ISO)

stress-related disorder (ISO)

Volvulus Of Midgut (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2-deoxy-D-glucose (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

DDE (EXP)

dibutyl phthalate (EXP)

dichlorine (EXP)

dorsomorphin (ISO)

ethylparaben (ISO)

fluoxetine (ISO)

fonofos (ISO)

fulvestrant (ISO)

genistein (EXP)

lead diacetate (EXP,ISO)

lipopolysaccharide (ISO)

methoxychlor (EXP)

morphine (ISO)

N-methyl-4-phenylpyridinium (ISO)

Nonylphenol (EXP)

ozone (EXP)

paracetamol (ISO)

parathion (ISO)

PCB138 (ISO)

phenylmercury acetate (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

terbufos (ISO)

thioglycolic acid (EXP)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP)

G protein-coupled receptor signaling pathway (IDA)

neuropeptide signaling pathway (IBA)

positive regulation of cortisol secretion (ISO)

positive regulation of cytosolic calcium ion concentration (IEA)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

Cellular Component

plasma membrane (IBA,ISO)

Molecular Function

G protein-coupled peptide receptor activity (IBA)

galanin receptor activity (IDA,IMP,ISO)

neuropeptide binding (IDA,IMP)

peptide hormone binding (ISO,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Galanin enhances corticosterone secretion from dispersed rat adrenocortical cells through the activation of GAL-R1 and GAL-R2 receptors coupled to the adenylate cyclase-dependent signaling cascade.	Andreis PG, etal., Int J Mol Med. 2007 Jan;19(1):149-55.
2.	Two genes in the rat homologous to human NKG2.	Berg SF, etal., Eur J Immunol 1998 Feb;28(2):444-50
3.	Elevated expression of galanin receptors in childhood neuroblastic tumors.	Berger A, etal., Neuroendocrinology 2002 Feb;75(2):130-8.
4.	Expression of GalR1 and GalR2 galanin receptor messenger ribonucleic acid in proopiomelanocortin neurons of the rat arcuate nucleus: effect of testosterone.	Bouret S, etal., Endocrinology 2000 May;141(5):1780-94
5.	Cloning, pharmacological characterization, and anatomical distribution of a rat cDNA encoding for a galanin receptor.	Burgevin MC, etal., J Mol Neurosci 1995;6(1):33-41.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.	The galanin receptor 1 gene associates with tobacco craving in smokers seeking cessation treatment.	Lori A, etal., Neuropsychopharmacology. 2011 Jun;36(7):1412-20. doi: 10.1038/npp.2011.25. Epub 2011 Mar 23.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Functional μ-Opioid-Galanin Receptor Heteromers in the Ventral Tegmental Area.	Moreno E, etal., J Neurosci. 2017 Feb 1;37(5):1176-1186. doi: 10.1523/JNEUROSCI.2442-16.2016. Epub 2016 Dec 22.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Cloning and characterization of the rat GALR1 galanin receptor from Rin14B insulinoma cells.	Parker EM, etal., Brain Res Mol Brain Res 1995 Dec 28;34(2):179-89.
14.	Further evidence for the association of GAL, GALR1 and NPY1R variants with opioid dependence.	Randesi M, etal., Pharmacogenomics. 2020 Aug;21(13):903-917. doi: 10.2217/pgs-2020-0045. Epub 2020 Aug 6.
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Human galanin (GAL) and galanin 1 receptor (GALR1) variations are not involved in fat intake and early onset obesity.	Schauble N, etal., J Nutr. 2005 Jun;135(6):1387-92.
19.	Expression cloning of a rat hypothalamic galanin receptor coupled to phosphoinositide turnover.	Smith KE, etal., J Biol Chem 1997 Sep 26;272(39):24612-6.
20.	Expression of galanin receptor-1 (GALR1) in the rat trigeminal ganglia and molar teeth.	Suzuki H, etal., Neurosci Res 2002 Mar;42(3):197-207.
21.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
22.	Differential intracellular signaling of the GalR1 and GalR2 galanin receptor subtypes.	Wang S, etal., Biochemistry. 1998 May 12;37(19):6711-7.
23.	Upregulation of galanin binding sites and GalR1 mRNA levels in the mouse locus coeruleus following chronic morphine treatments and precipitated morphine withdrawal.	Zachariou V, etal., Neuropsychopharmacology. 2000 Aug;23(2):127-37. doi: 10.1016/S0893-133X(00)00094-4.
24.	The role of galanin system in modulating depression, anxiety, and addiction-like behaviors after chronic restraint stress.	Zhao X, etal., Neuroscience. 2013 Aug 29;246:82-93. doi: 10.1016/j.neuroscience.2013.04.046. Epub 2013 Apr 30.

Additional References at PubMed

PMID:14623054	PMID:14764000	PMID:15885774	PMID:15944003	PMID:15944004	PMID:16626647	PMID:17982695	PMID:18172432	PMID:19006083	PMID:21593325	PMID:21880366	PMID:21894515
PMID:22197078	PMID:24517231	PMID:24614744	PMID:24766650	PMID:27041232	PMID:27127795	PMID:27457954	PMID:28062253	PMID:29127424	PMID:29852172	PMID:34086200	PMID:34108238

Genomics

Comparative Map Data

Galr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	78,046,803 - 78,062,359 (-)	NCBI		GRCr8
mRatBN7.2	18	75,772,021 - 75,787,577 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	75,772,023 - 75,787,577 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	77,873,305 - 77,888,899 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	78,543,582 - 78,559,170 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	76,391,102 - 76,406,704 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	79,243,009 - 79,258,570 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	79,243,009 - 79,258,570 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	78,302,017 - 78,317,578 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	78,858,892 - 78,874,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	78,941,425 - 78,947,496 (-)	NCBI
Celera	18	74,409,272 - 74,424,831 (-)	NCBI		Celera
RH 3.4 Map	18	809.9	RGD
Cytogenetic Map	18	q12.3	NCBI

GALR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	77,249,848 - 77,277,900 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	77,249,848 - 77,277,900 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	74,961,804 - 74,989,856 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	73,090,721 - 73,111,081 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	73,090,720 - 73,111,081	NCBI
Celera	18	71,781,397 - 71,801,439 (+)	NCBI		Celera
Cytogenetic Map	18	q23	NCBI
HuRef	18	71,642,787 - 71,663,380 (+)	NCBI		HuRef
CHM1_1	18	74,958,364 - 74,978,152 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	77,480,984 - 77,510,848 (+)	NCBI		T2T-CHM13v2.0

Galr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	82,410,621 - 82,424,902 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	82,410,505 - 82,424,902 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	82,392,496 - 82,406,777 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	82,392,380 - 82,406,777 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	82,561,888 - 82,576,169 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	82,527,838 - 82,541,229 (-)	NCBI		MGSCv36	mm8
Celera	18	83,464,283 - 83,478,564 (-)	NCBI		Celera
Cytogenetic Map	18	E3	NCBI
cM Map	18	55.78	NCBI

Galr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	60,546,186 - 60,559,298 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	60,449,660 - 60,559,549 (+)	NCBI	ChiLan1.0	ChiLan1.0

GALR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	94,795,870 - 94,824,732 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	80,488,494 - 80,516,608 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	70,643,718 - 70,664,068 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	73,899,995 - 73,917,849 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	73,899,995 - 73,917,752 (+)	Ensembl	panpan1.1		panPan2

GALR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	2,750,117 - 2,785,329 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	2,729,331 - 2,742,231 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	1	2,729,331 - 2,742,231 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	3,728,748 - 3,802,391 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	2,528,062 - 2,601,762 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	2,532,833 - 2,548,666 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	2,573,436 - 2,647,073 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	2,523,851 - 2,597,515 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	2,694,052 - 2,767,702 (-)	NCBI		UU_Cfam_GSD_1.0

Galr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	16,679,669 - 16,700,474 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936616	2,007,352 - 2,020,737 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936616	2,007,339 - 2,020,737 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GALR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	147,443,821 - 147,463,542 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	147,442,977 - 147,466,731 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	162,977,166 - 162,994,822 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GALR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	2,719,736 - 2,739,018 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666060	23,243,960 - 23,263,451 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Galr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624806	3,334,325 - 3,347,087 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624806	3,331,025 - 3,347,774 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Galr1
103 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	867
Count of miRNA genes:	300
Interacting mature miRNAs:	396
Transcripts:	ENSRNOT00000022335, ENSRNOT00000022401
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	60622311	77209844	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
634333	Pia19	Pristane induced arthritis QTL 19	3.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	73997140	79532029	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	59712417	76477814	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	60622311	77209844	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat

Markers in Region

D18Chm74

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	75,781,593 - 75,781,783 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	79,252,584 - 79,252,773	NCBI	Rnor6.0
Rnor_5.0	18	78,311,592 - 78,311,781	UniSTS	Rnor5.0
RGSC_v3.4	18	78,868,465 - 78,868,654	UniSTS	RGSC3.4
Celera	18	74,418,845 - 74,419,034	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

D18Chm73

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	75,778,396 - 75,778,588 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	79,249,385 - 79,249,576	NCBI	Rnor6.0
Rnor_5.0	18	78,308,393 - 78,308,584	UniSTS	Rnor5.0
RGSC_v3.4	18	78,865,268 - 78,865,459	UniSTS	RGSC3.4
Celera	18	74,415,648 - 74,415,839	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH94734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	75,773,094 - 75,773,219 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	79,244,083 - 79,244,207	NCBI	Rnor6.0
Rnor_5.0	18	78,303,091 - 78,303,215	UniSTS	Rnor5.0
RGSC_v3.4	18	78,859,966 - 78,860,090	UniSTS	RGSC3.4
Celera	18	74,410,346 - 74,410,470	UniSTS
RH 3.4 Map	18	809.9	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	3	93	16	19	4	11	4	1	48	15	92	21	28	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U30290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U33193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022401 ⟹ ENSRNOP00000022400

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	75,772,023 - 75,787,577 (-)	Ensembl
Rnor_6.0 Ensembl	18	79,243,009 - 79,258,570 (-)	Ensembl

RefSeq Acc Id:

NM_012958 ⟹ NP_037090

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	78,046,803 - 78,062,359 (-)	NCBI
mRatBN7.2	18	75,772,021 - 75,787,577 (-)	NCBI
Rnor_6.0	18	79,243,009 - 79,258,570 (-)	NCBI
Rnor_5.0	18	78,302,017 - 78,317,578 (-)	NCBI
RGSC_v3.4	18	78,858,892 - 78,874,451 (-)	RGD
Celera	18	74,409,272 - 74,424,831 (-)	RGD

Sequence:

show sequence

GCCAGGCCAGGGAAGAGGATAGCGAGATCAGGCACAGCCCGGGTCACTGTCCTCTGCTGTCTTG
CCGGTTGCGGGAGGTTCTAGCTGGAGACGCGCGCTCTCTCCGCGCTGTCTAGGGCCATCCTGTG
ACCCTAGGCTACCTCCAGAGCTGGCTTTCCCTGGCTGGCACAACTCTCCAAGGAGCTCCGGTCC
ATTGCACAGCGCCCCAAGGGGGTGTCTCAGTAAGTGATGGAACTGGCTCCGGTGAACCTCAGTG
AAGGGAATGGGAGCGACCCTGAACCTCCAGCGGAACCCAGGCCGCTCTTCGGCATCGGCGTGGA
GAACTTCATCACGCTGGTGGTGTTTGGCCTTATTTTCGCGATGGGCGTGCTGGGCAACAGCCTG
GTGATCACCGTGCTGGCGCGCAGCAAACCGGGCAAGCCGCGCAGCACCACCAACCTGTTCATCC
TCAACCTGAGCATCGCAGACCTGGCCTACCTGCTCTTCTGCATCCCTTTCCAGGCCACCGTGTA
CGCACTGCCCACCTGGGTGCTGGGCGCCTTCATCTGCAAGTTTATACACTACTTCTTCACCGTG
TCCATGCTCGTGAGCATCTTCACCCTGGCCGCGATGTCTGTGGATCGCTATGTGGCCATTGTGC
ATTCACGGCGCTCCTCCTCCCTCAGGGTGTCCCGCAACGCGCTGCTGGGCGTGGGCTTCATCTG
GGCGCTGTCCATCGCTATGGCCTCGCCGGTGGCCTACTACCAGCGCCTTTTTCATCGGGACAGC
AACCAAACCTTCTGCTGGGAGCACTGGCCCAACCAACTCCACAAGAAGGCTTACGTGGTGTGCA
CTTTCGTCTTTGGTTACCTTCTGCCCTTACTGCTCATCTGCTTTTGCTATGCCAAGGTTCTCAA
TCATCTGCATAAAAAGTTGAAGAACATGTCAAAAAAGTCAGAGGCATCCAAGAAAAAGACTGCA
CAGACTGTCCTGGTGGTCGTTGTGGTATTTGGCATATCATGGCTGCCCCATCATGTCATCCACC
TCTGGGCTGAGTTCGGAGCATTCCCGCTGACCCCAGCTTCCTTCTTCTTCAGAATCACTGCCCA
CTGCCTGGCATACAGCAACTCCTCGGTGAACCCCATCATCTACGCCTTTCTCTCAGAAAACTTC
CGGAAGGCGTACAAGCAAGTGTTCAAGTGCCGTGTTTGCAATGAGTCGCCGCACGGCGATGCTA
AAGAAAAGAACCGAATAGATACCCCGCCCTCCACCAACTGCACCCACGTGTGAAGGTTGGCCAG
AGCCTCCTGTCCTCCGCTCCCATGTGTGTTAGAGAGGGGAGGACACAGTGAATTATCAAGTAAC
ATGGCAGCTCGTTCTCCTGACAGCAATTCCTATCATTCTAACAACATTCCACAGCGGTGAAAGC
ACTTTGATTGTCCAGGGAACTCCTCGGTCTACTGAAGATTATTTCCCAATTTTATTTCATTTTA
TGATTGTATTTATGAAGCAAAAGAAACTTCCATATAGCTTCTATCTTTTAAGGGATGAAAGTCC
AACAGCGCACTGCAGATATGTTCTGATCTCCATGATACAAACCAAGTTCTAGGAAGCAATGAAG
ATTATTTGAAATCCACATTTTAAGGCCAGTTAATATAGGGAAACAGTTCTCTTTCTTTTAATGA
TGTAGTATTCTAGTTTTGAAATACATTTGTGGGCCCAGAATAGTGAATTTTATTTTACTGAACC
TTTGTGGACTGGCACCTCTTCCGAGTCAGGGGAGGCTTTTCAAAGTCTGTTCCCATAGGTGTAC
AGAGTTCTGTCTGGGAACGTGAGACTCACCAAGTTCATCTCAGGAGATCATTGGTGACTCCACT
TTGAAGTAATCCTGTGGACTAAGACACCAGGGAGTCTGCTGTGGACGGCTACAAACCTGCCTGT
TGTAGCTTTAAGGATGTTCTTGGCAAATTATTAGCTGGGCCTCCAAAGAACCCAGGAAACCAGT
CAGCCAACAGTTTCCACGGGGTTGAAAACTGGACAAAACTTAGCCACGTAGTTAATATTCATGC
CGCATGGAGAAAGCAGGAAAGATGCTTGATTCCGAATGAGCAAAGACAAAGGTATCCTGTGGGA
GAATAGATAAACACTTAGAGACGTGATGCCTTATGCAGACTTGTACCGACAACTGTTTAATGAT
TGTTTTCCCCAAACATTATTCCCTGGGGCAATTAATTTAGAATTAAAATCACCACCACGTGACT
TGCAAATGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037090	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA99741	(Get FASTA)	NCBI Sequence Viewer
	AAC52438	(Get FASTA)	NCBI Sequence Viewer
	EDL75210	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022400.1
	ENSRNOP00055018876
	ENSRNOP00060020905
	ENSRNOP00065002709
GenBank Protein	Q62805	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037090 ⟸ NM_012958

- UniProtKB:

Q62805 (UniProtKB/Swiss-Prot), A6K5J0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARSKPGK
PRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAM
SVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDSNQTFCWEHWPNQ
LHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGI
SWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCRV
CNESPHGDAKEKNRIDTPPSTNCTHV

hide sequence

Ensembl Acc Id:

ENSRNOP00000022400 ⟸ ENSRNOT00000022401

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62805-F1-model_v2	AlphaFold	Q62805	1-346	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2656	AgrOrtholog
BioCyc Gene	G2FUF-6798	BioCyc
Ensembl Genes	ENSRNOG00000016654	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055013560	UniProtKB/Swiss-Prot
	ENSRNOG00060015234	UniProtKB/Swiss-Prot
	ENSRNOG00065002805	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022401.3	UniProtKB/Swiss-Prot
	ENSRNOT00055023247	UniProtKB/Swiss-Prot
	ENSRNOT00060026112	UniProtKB/Swiss-Prot
	ENSRNOT00065003850	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GAL1_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Galanin_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:50577	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	50577	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR 15-LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LEUCOKININ RECEPTOR-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Galr1	PhenoGen
PRINTS	GALANIN1R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GALANINR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016654	RatGTEx
	ENSRNOG00055013560	RatGTEx
	ENSRNOG00060015234	RatGTEx
	ENSRNOG00065002805	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC215478
UniProt	A6K5J0	ENTREZGENE, UniProtKB/TrEMBL
	GALR1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Description	Reference	Status
2002-06-10	Galr1	galanin receptor 1	Symbol and Name status set to approved	70586	APPROVED
2000-11-11	Galr1	Galanin Receptor 1	Symbol updated	61033	APPROVED
2000-11-11	Galnr1	Galanin Receptor 1	Symbol withdrawn	61033	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed by most POMC (precursor molecule for the opioid peptide beta-endorphin) neurons in rostral parts of the nucleus	61034
gene_expression	expressed by most POMC (precursor molecule for the opioid peptide beta-endorphin) neurons in rostral parts of the nucleus	61084
gene_function	receptor for neuropeptide galanin	61034
gene_function	receptor for neuropeptide galanin	61084
gene_process	involved in the control of pituitary functions and feeding behavior and in modulating POMC neuron activity	61034
gene_process	involved in the control of pituitary functions and feeding behavior and in modulating POMC neuron activity	61084
gene_regulation	expression modulated by testosterone	61034
gene_regulation	expression modulated by testosterone	61084

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD