Symbol:
Fnta
Name:
farnesyltransferase, CAAX box, subunit alpha
RGD ID:
2625
Description:
Contributes to several functions, including peptide binding activity; protein prenyltransferase activity; and zinc ion binding activity. Involved in negative regulation of apoptotic process; positive regulation of cell cycle; and positive regulation of cell population proliferation. Part of CAAX-protein geranylgeranyltransferase complex. Orthologous to human FNTA (farnesyltransferase, CAAX box, subunit alpha); INTERACTS WITH (+)-schisandrin B; (S)-(-)-perillyl alcohol; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CAAX farnesyltransferase subunit alpha; Farnesyltransferase subunit alpha; farnesyltransferase, CAAX box, alpha; Farnesyltransferase, subunit alpha; FTase-alpha; GGTase-I-alpha; PFAS; protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase subunit alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FNTA (farnesyltransferase, CAAX box, subunit alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fnta (farnesyltransferase, CAAX box, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fnta (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FNTA (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FNTA (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fnta (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FNTA (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FNTA (farnesyltransferase, CAAX box, subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Fnta (farnesyltransferase, CAAX box, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FNTA (farnesyltransferase, CAAX box, subunit alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fnta (farnesyltransferase, CAAX box, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fnta-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Fnta
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RAM2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fnta
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,767,864 - 72,786,193 (+) NCBI GRCr8 mRatBN7.2 16 66,065,131 - 66,083,460 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,065,132 - 66,083,460 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,343,827 - 71,362,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,750,156 - 74,768,528 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 69,990,195 - 70,008,625 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 70,834,957 - 70,854,724 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 70,834,957 - 70,854,724 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,499,605 - 70,519,062 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,440,340 - 70,458,433 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,440,604 - 70,458,698 (+) NCBI Celera 16 63,976,260 - 63,994,463 (+) NCBI Celera RH 3.4 Map 16 622.7 RGD Cytogenetic Map 16 q12.4 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Molecular Function
acetyltransferase activator activity (IEA,ISO) alpha-tubulin binding (IEA,ISO) CAAX-protein geranylgeranyltransferase activity (IBA,IDA,IEA) enzyme binding (IEA,ISO) heterocyclic compound binding (IDA) microtubule binding (IEA,ISO) molecular adaptor activity (ISO) peptide binding (IDA) prenyltransferase activity (IEA) protein binding (IPI,ISO) protein farnesyltransferase activity (IBA,IDA,IEA,ISO) protein geranylgeranyltransferase activity (IEA,ISO,ISS) protein prenyltransferase activity (IEA) Rab geranylgeranyltransferase activity (IEA,ISO) receptor tyrosine kinase binding (IEA,ISO) small molecule binding (IDA) transferase activity (IEA) zinc ion binding (IDA)
1.
Cloning and expression of a cDNA encoding the alpha subunit of rat p21ras protein farnesyltransferase.
Chen WJ, etal., Proc Natl Acad Sci U S A 1991 Dec 15;88(24):11368-72.
2.
Novel and selective imidazole-containing biphenyl inhibitors of protein farnesyltransferase.
Curtin ML, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1367-71.
3.
Isothiazole dioxide derivative 6n inhibits vascular smooth muscle cell proliferation and protein farnesylation.
Ferri N, etal., Biochem Pharmacol. 2005 Dec 5;70(12):1735-43. Epub 2005 Oct 28.
4.
Inhibition of protein geranylgeranylation causes a superinduction of nitric-oxide synthase-2 by interleukin-1beta in vascular smooth muscle cells.
Finder JD, etal., J Biol Chem. 1997 May 23;272(21):13484-8.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1359-62.
8.
Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1363-6.
9.
Inactivation of farnesyltransferase and geranylgeranyltransferase I by caspase-3: cleavage of the common alpha subunit during apoptosis.
Kim KW, etal., Oncogene. 2001 Jan 18;20(3):358-66.
10.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
11.
Reaction path of protein farnesyltransferase at atomic resolution.
Long SB, etal., Nature 2002 Oct 10;419(6907):645-50.
12.
The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.
Long SB, etal., Structure. 2000 Feb 15;8(2):209-22.
13.
Combination of the novel farnesyltransferase inhibitor RPR130401 and the geranylgeranyltransferase-1 inhibitor GGTI-298 disrupts MAP kinase activation and G(1)-S transition in Ki-Ras-overexpressing transformed adrenocortical cells.
Mazet JL, etal., FEBS Lett. 1999 Oct 29;460(2):235-40.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
Park HW, etal., Science. 1997 Mar 21;275(5307):1800-4.
17.
Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.
Reid TS and Beese LS, Biochemistry. 2004 Jun 8;43(22):6877-84.
18.
Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.
Reid TS, etal., Biochemistry. 2004 Jul 20;43(28):9000-8.
19.
Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
Reid TS, etal., J Mol Biol. 2004 Oct 15;343(2):417-33.
20.
GOA pipeline
RGD automated data pipeline
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Role of the carboxyterminal residue in peptide binding to protein farnesyltransferase and protein geranylgeranyltransferase.
Roskoski R Jr and Ritchie P, Arch Biochem Biophys. 1998 Aug 15;356(2):167-76.
23.
Tricyclic farnesyl protein transferase inhibitors: crystallographic and calorimetric studies of structure-activity relationships.
Strickland CL, etal., J Med Chem. 1999 Jun 17;42(12):2125-35.
24.
Structure of mammalian protein geranylgeranyltransferase type-I.
Taylor JS, etal., EMBO J. 2003 Nov 17;22(22):5963-74.
25.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
26.
Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
Tong Y, etal., Bioorg Med Chem Lett. 2003 May 5;13(9):1571-4.
27.
Biochemical and structural studies with prenyl diphosphate analogues provide insights into isoprenoid recognition by protein farnesyl transferase.
Turek-Etienne TC, etal., Biochemistry. 2003 Apr 8;42(13):3716-24.
28.
Dominant-negative alpha-subunit of farnesyl- and geranyltransferase inhibits glucose-stimulated, but not KCl-stimulated, insulin secretion in INS 832/13 cells.
Veluthakal R, etal., Diabetes. 2007 Jan;56(1):204-10.
29.
Properties and kinetic mechanism of recombinant mammalian protein geranylgeranyltransferase type I.
Zhang FL, etal., J Biol Chem. 1994 Sep 23;269(38):23465-70.
30.
TrkB-mediated activation of geranylgeranyltransferase I promotes dendritic morphogenesis.
Zhou XP, etal., Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17181-6. Epub 2008 Oct 28.
Fnta Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,767,864 - 72,786,193 (+) NCBI GRCr8 mRatBN7.2 16 66,065,131 - 66,083,460 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,065,132 - 66,083,460 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,343,827 - 71,362,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,750,156 - 74,768,528 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 69,990,195 - 70,008,625 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 70,834,957 - 70,854,724 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 70,834,957 - 70,854,724 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,499,605 - 70,519,062 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,440,340 - 70,458,433 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,440,604 - 70,458,698 (+) NCBI Celera 16 63,976,260 - 63,994,463 (+) NCBI Celera RH 3.4 Map 16 622.7 RGD Cytogenetic Map 16 q12.4 NCBI
FNTA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 43,056,323 - 43,085,785 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 43,034,194 - 43,085,788 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 42,911,466 - 42,940,928 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 43,030,599 - 43,060,088 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 43,030,640 - 43,060,080 NCBI Celera 8 41,859,884 - 41,889,630 (+) NCBI Celera Cytogenetic Map 8 p11.21 NCBI HuRef 8 41,434,064 - 41,463,781 (+) NCBI HuRef CHM1_1 8 42,958,364 - 42,987,853 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 43,325,268 - 43,354,718 (+) NCBI T2T-CHM13v2.0
Fnta Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 26,488,716 - 26,505,638 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 26,488,750 - 26,505,678 (-) Ensembl GRCm39 Ensembl GRCm38 8 25,998,688 - 26,015,610 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 25,998,722 - 26,015,650 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 27,109,194 - 27,126,073 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 27,464,267 - 27,481,146 (-) NCBI MGSCv36 mm8 Celera 8 27,468,460 - 27,485,887 (-) NCBI Celera Cytogenetic Map 8 A2 NCBI cM Map 8 14.27 NCBI
Fnta Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955457 13,260,545 - 13,294,025 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955457 13,260,825 - 13,294,025 (+) NCBI ChiLan1.0 ChiLan1.0
FNTA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 61,512,173 - 61,542,875 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 37,229,091 - 37,258,862 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 42,303,987 - 42,333,743 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 39,744,142 - 39,774,039 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 39,743,768 - 39,774,031 (+) Ensembl panpan1.1 panPan2
FNTA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 22,739,070 - 22,767,942 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 22,739,079 - 22,767,914 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 23,244,269 - 23,273,147 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 24,491,021 - 24,519,909 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 24,491,022 - 24,652,650 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 22,859,185 - 22,888,061 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 23,424,042 - 23,452,916 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 23,475,354 - 23,504,242 (-) NCBI UU_Cfam_GSD_1.0
Fnta
FNTA
FNTA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 41,057,798 - 41,088,210 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 41,057,603 - 41,087,705 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 681,570 - 712,699 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 43 Interacting mature miRNAs: 47 Transcripts: ENSRNOT00000019594 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat
D8Rck2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 66,083,188 - 66,083,420 (+) MAPPER mRatBN7.2 Rnor_6.0 16 70,854,453 - 70,854,684 NCBI Rnor6.0 Rnor_5.0 16 70,518,791 - 70,519,022 UniSTS Rnor5.0 RGSC_v3.4 16 70,458,162 - 70,458,393 UniSTS RGSC3.4 Celera 16 63,994,192 - 63,994,423 UniSTS Cytogenetic Map 16 q12.4 UniSTS
RH94481
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 66,083,261 - 66,083,431 (+) MAPPER mRatBN7.2 Rnor_6.0 16 70,854,526 - 70,854,695 NCBI Rnor6.0 Rnor_5.0 16 70,518,864 - 70,519,033 UniSTS Rnor5.0 RGSC_v3.4 16 70,458,235 - 70,458,404 UniSTS RGSC3.4 Celera 16 63,994,265 - 63,994,434 UniSTS RH 3.4 Map 16 622.7 UniSTS Cytogenetic Map 16 q12.4 UniSTS
BI274352
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 66,083,057 - 66,083,262 (+) MAPPER mRatBN7.2 Rnor_6.0 16 70,854,322 - 70,854,526 NCBI Rnor6.0 Rnor_5.0 16 70,518,660 - 70,518,864 UniSTS Rnor5.0 RGSC_v3.4 16 70,458,031 - 70,458,235 UniSTS RGSC3.4 Celera 16 63,994,061 - 63,994,265 UniSTS RH 3.4 Map 16 620.8 UniSTS Cytogenetic Map 16 q12.4 UniSTS
BI282482
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 66,083,250 - 66,083,402 (+) MAPPER mRatBN7.2 Rnor_6.0 16 70,854,515 - 70,854,666 NCBI Rnor6.0 Rnor_5.0 16 70,518,853 - 70,519,004 UniSTS Rnor5.0 RGSC_v3.4 16 70,458,224 - 70,458,375 UniSTS RGSC3.4 Celera 16 63,994,254 - 63,994,405 UniSTS RH 3.4 Map 16 620.3 UniSTS Cytogenetic Map 16 q12.4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019594 ⟹ ENSRNOP00000019594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,065,132 - 66,083,460 (+) Ensembl Rnor_6.0 Ensembl 16 70,834,957 - 70,854,724 (+) Ensembl
RefSeq Acc Id:
NM_012847 ⟹ NP_036979
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,767,864 - 72,786,193 (+) NCBI mRatBN7.2 16 66,065,131 - 66,083,460 (+) NCBI Rnor_6.0 16 70,834,957 - 70,854,724 (+) NCBI Rnor_5.0 16 70,499,605 - 70,519,062 (+) NCBI RGSC_v3.4 16 70,440,340 - 70,458,433 (+) RGD Celera 16 63,976,260 - 63,994,463 (+) RGD
Sequence:
GCGGGCCGCGGAGGGGGCGGGGCTCCACCACCACCTCAGCTGCGGACGGAGGCGAGATGGCGGCCACTGAGGGGGTCGGGGAATCTGCGCCAGGCGGTGAGCCGGGACAGCCAGAGCAGCCGCCGCCC
hide sequence
RefSeq Acc Id:
NP_036979 ⟸ NM_012847
- UniProtKB:
Q04631 (UniProtKB/Swiss-Prot), Q5RKJ4 (UniProtKB/TrEMBL), F7FMZ5 (UniProtKB/TrEMBL)
- Sequence:
MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNA
hide sequence
Ensembl Acc Id:
ENSRNOP00000019594 ⟸ ENSRNOT00000019594
RGD ID: 13700161 Promoter ID: EPDNEW_R10685 Type: multiple initiation site Name: Fnta_1 Description: farnesyltransferase, CAAX box, alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 70,834,990 - 70,835,050 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-03-29
Fnta
farnesyltransferase, CAAX box, subunit alpha
Fnta
farnesyltransferase, CAAX box, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Fnta
farnesyltransferase, CAAX box, alpha
Farnesyltransferase, subunit alpha
Name updated
625702 APPROVED
2002-06-10
Fnta
Farnesyltransferase, subunit alpha
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_drugs
inhibitors of farnesyltransferase cause tumour regression in animals and are currently being evaluated in clinical trails for the treatment of human cancer
625725
gene_function
catalyzes the formation of thioether linkages between the C1 atom of farnesyl (15-carbon ) isoprenoid lipids and cysteine residues at or near the carboxy-terminus of protein acceptors
625725
gene_protein
377 amino acids
728420
