Fnta (farnesyltransferase, CAAX box, subunit alpha)

Advanced Search (OLGA)

Gene: Fnta (farnesyltransferase, CAAX box, subunit alpha) Rattus norvegicus

Analyze

Symbol:

Fnta

Name:

farnesyltransferase, CAAX box, subunit alpha (Ensembl:farnesyltransferase, CAAX box, alpha)

RGD ID:

2625

Description:

Contributes to several functions, including peptide binding activity; protein prenyltransferase activity; and zinc ion binding activity. Involved in several processes, including negative regulation of apoptotic process; positive regulation of cell population proliferation; and regulation of nitric-oxide synthase biosynthetic process. Part of CAAX-protein geranylgeranyltransferase complex. Orthologous to human FNTA (farnesyltransferase, CAAX box, subunit alpha); INTERACTS WITH (+)-schisandrin B; (S)-(-)-perillyl alcohol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CAAX farnesyltransferase subunit alpha; Farnesyltransferase subunit alpha; farnesyltransferase, CAAX box, alpha; Farnesyltransferase, subunit alpha; FTase-alpha; GGTase-I-alpha; PFAS; protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase subunit alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fnta (farnesyltransferase, CAAX box, alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fnta (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fnta (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Fnta (farnesyltransferase, CAAX box, alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fnta (farnesyltransferase, CAAX box, alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fnta-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fnta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RAM2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fnta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	72,767,864 - 72,786,193 (+)	NCBI		GRCr8
mRatBN7.2	16	66,065,131 - 66,083,460 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	66,065,132 - 66,083,460 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	71,343,827 - 71,362,199 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	74,750,156 - 74,768,528 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	69,990,195 - 70,008,625 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	70,834,957 - 70,854,724 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	70,834,957 - 70,854,724 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	70,499,605 - 70,519,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	70,440,340 - 70,458,433 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	70,440,604 - 70,458,698 (+)	NCBI
Celera	16	63,976,260 - 63,994,463 (+)	NCBI		Celera
RH 3.4 Map	16	622.7	RGD
Cytogenetic Map	16	q12.4	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital muscular dystrophy-dystroglycanopathy type A12 (ISO)

Idiopathic Basal Ganglia Calcification 1 (ISO)

IMMUNODEFICIENCY 15 (ISO)

immunodeficiency 15B (ISO)

mucopolysaccharidosis type IIIC (ISO)

torsion dystonia 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

(S)-(-)-perillyl alcohol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-trans,6-trans-farnesyl diphosphate (EXP)

5-aza-2'-deoxycytidine (ISO)

acrolein (ISO)

all-trans-retinol (EXP)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

asbestos (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

capsaicin (EXP)

carbon nanotube (ISO)

carmustine (ISO)

cobalt dichloride (ISO)

coumarin (ISO)

cyclosporin A (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

farnesol (ISO)

farnesyl diphosphate (EXP)

fluvastatin (ISO)

folic acid (ISO)

gentamycin (EXP)

GW 4064 (ISO)

GW 7647 (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead(0) (ISO)

methyl methanesulfonate (ISO)

oleic acid (ISO)

ozone (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

perillyl alcohol (EXP)

quercetin (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

valproic acid (ISO)

vitamin K (EXP)

zinc atom (EXP)

zinc(0) (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

enzyme-linked receptor protein signaling pathway (IEA,ISO)

negative regulation of apoptotic process (IMP)

peptide pheromone maturation (IBA)

positive regulation of cell cycle (IMP)

positive regulation of cell population proliferation (IMP)

positive regulation of deacetylase activity (ISO)

positive regulation of Rac protein signal transduction (IEA,ISO)

positive regulation of skeletal muscle acetylcholine-gated channel clustering (IEA,ISO)

positive regulation of tubulin deacetylation (IEA,ISO)

protein farnesylation (ISO,ISS)

protein geranylgeranylation (ISO,ISS)

skeletal muscle acetylcholine-gated channel clustering (IEA)

Cellular Component

CAAX-protein geranylgeranyltransferase complex (IBA,IDA,IEA,ISO)

cytoplasm (IBA)

microtubule associated complex (IEA,ISO)

plasma membrane (IEA)

protein farnesyltransferase complex (IBA,IEA,ISO,ISS)

Molecular Function

alpha-tubulin binding (IEA,ISO)

CAAX-protein geranylgeranyltransferase activity (IBA,IDA)

heterocyclic compound binding (IDA)

microtubule binding (IEA,ISO)

molecular adaptor activity (ISO)

peptide binding (IDA)

protein binding (IPI,ISO)

protein farnesyltransferase activity (IBA,IDA,IEA,ISO)

protein geranylgeranyltransferase activity (ISO,ISS)

Rab geranylgeranyltransferase activity (IEA,ISO)

receptor tyrosine kinase binding (IEA,ISO)

small molecule binding (IDA)

zinc ion binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and expression of a cDNA encoding the alpha subunit of rat p21ras protein farnesyltransferase.	Chen WJ, etal., Proc Natl Acad Sci U S A 1991 Dec 15;88(24):11368-72.
2.	Novel and selective imidazole-containing biphenyl inhibitors of protein farnesyltransferase.	Curtin ML, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1367-71.
3.	Isothiazole dioxide derivative 6n inhibits vascular smooth muscle cell proliferation and protein farnesylation.	Ferri N, etal., Biochem Pharmacol. 2005 Dec 5;70(12):1735-43. Epub 2005 Oct 28.
4.	Inhibition of protein geranylgeranylation causes a superinduction of nitric-oxide synthase-2 by interleukin-1beta in vascular smooth muscle cells.	Finder JD, etal., J Biol Chem. 1997 May 23;272(21):13484-8.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.	Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1359-62.
8.	Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.	Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1363-6.
9.	Inactivation of farnesyltransferase and geranylgeranyltransferase I by caspase-3: cleavage of the common alpha subunit during apoptosis.	Kim KW, etal., Oncogene. 2001 Jan 18;20(3):358-66.
10.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
11.	Reaction path of protein farnesyltransferase at atomic resolution.	Long SB, etal., Nature 2002 Oct 10;419(6907):645-50.
12.	The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.	Long SB, etal., Structure. 2000 Feb 15;8(2):209-22.
13.	Combination of the novel farnesyltransferase inhibitor RPR130401 and the geranylgeranyltransferase-1 inhibitor GGTI-298 disrupts MAP kinase activation and G(1)-S transition in Ki-Ras-overexpressing transformed adrenocortical cells.	Mazet JL, etal., FEBS Lett. 1999 Oct 29;460(2):235-40.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.	Park HW, etal., Science. 1997 Mar 21;275(5307):1800-4.
17.	Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.	Reid TS and Beese LS, Biochemistry. 2004 Jun 8;43(22):6877-84.
18.	Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.	Reid TS, etal., Biochemistry. 2004 Jul 20;43(28):9000-8.
19.	Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.	Reid TS, etal., J Mol Biol. 2004 Oct 15;343(2):417-33.
20.	GOA pipeline	RGD automated data pipeline
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Role of the carboxyterminal residue in peptide binding to protein farnesyltransferase and protein geranylgeranyltransferase.	Roskoski R Jr and Ritchie P, Arch Biochem Biophys. 1998 Aug 15;356(2):167-76.
23.	Tricyclic farnesyl protein transferase inhibitors: crystallographic and calorimetric studies of structure-activity relationships.	Strickland CL, etal., J Med Chem. 1999 Jun 17;42(12):2125-35.
24.	Structure of mammalian protein geranylgeranyltransferase type-I.	Taylor JS, etal., EMBO J. 2003 Nov 17;22(22):5963-74.
25.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
26.	Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.	Tong Y, etal., Bioorg Med Chem Lett. 2003 May 5;13(9):1571-4.
27.	Biochemical and structural studies with prenyl diphosphate analogues provide insights into isoprenoid recognition by protein farnesyl transferase.	Turek-Etienne TC, etal., Biochemistry. 2003 Apr 8;42(13):3716-24.
28.	Dominant-negative alpha-subunit of farnesyl- and geranyltransferase inhibits glucose-stimulated, but not KCl-stimulated, insulin secretion in INS 832/13 cells.	Veluthakal R, etal., Diabetes. 2007 Jan;56(1):204-10.
29.	Properties and kinetic mechanism of recombinant mammalian protein geranylgeranyltransferase type I.	Zhang FL, etal., J Biol Chem. 1994 Sep 23;269(38):23465-70.
30.	TrkB-mediated activation of geranylgeranyltransferase I promotes dendritic morphogenesis.	Zhou XP, etal., Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17181-6. Epub 2008 Oct 28.

Additional References at PubMed

PMID:7673206	PMID:9657673	PMID:9843427	PMID:11687658	PMID:12477932	PMID:14622576	PMID:16893176	PMID:19228685	PMID:23534605	PMID:29282289

Genomics

Comparative Map Data

Fnta
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	72,767,864 - 72,786,193 (+)	NCBI		GRCr8
mRatBN7.2	16	66,065,131 - 66,083,460 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	66,065,132 - 66,083,460 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	71,343,827 - 71,362,199 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	74,750,156 - 74,768,528 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	69,990,195 - 70,008,625 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	70,834,957 - 70,854,724 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	70,834,957 - 70,854,724 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	70,499,605 - 70,519,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	70,440,340 - 70,458,433 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	70,440,604 - 70,458,698 (+)	NCBI
Celera	16	63,976,260 - 63,994,463 (+)	NCBI		Celera
RH 3.4 Map	16	622.7	RGD
Cytogenetic Map	16	q12.4	NCBI

FNTA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	43,056,323 - 43,085,785 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	43,034,194 - 43,085,788 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	42,911,466 - 42,940,928 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	43,030,599 - 43,060,088 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	43,030,640 - 43,060,080	NCBI
Celera	8	41,859,884 - 41,889,630 (+)	NCBI		Celera
Cytogenetic Map	8	p11.21	NCBI
HuRef	8	41,434,064 - 41,463,781 (+)	NCBI		HuRef
CHM1_1	8	42,958,364 - 42,987,853 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	43,325,268 - 43,354,718 (+)	NCBI		T2T-CHM13v2.0

Fnta
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	26,488,716 - 26,505,638 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	26,488,750 - 26,505,678 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	25,998,688 - 26,015,610 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	25,998,722 - 26,015,650 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	27,109,194 - 27,126,073 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	27,464,267 - 27,481,146 (-)	NCBI		MGSCv36	mm8
Celera	8	27,468,460 - 27,485,887 (-)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	14.27	NCBI

Fnta
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955457	13,260,545 - 13,294,025 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955457	13,260,825 - 13,294,025 (+)	NCBI	ChiLan1.0	ChiLan1.0

FNTA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	61,512,173 - 61,542,875 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	37,229,091 - 37,258,862 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	42,303,987 - 42,333,743 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	39,744,142 - 39,774,039 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	39,743,768 - 39,774,031 (+)	Ensembl	panpan1.1		panPan2

FNTA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	22,739,070 - 22,767,942 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	22,739,079 - 22,767,914 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	23,244,269 - 23,273,147 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	24,491,021 - 24,519,909 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	24,491,022 - 24,652,650 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	22,859,185 - 22,888,061 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	23,424,042 - 23,452,916 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	23,475,354 - 23,504,242 (-)	NCBI		UU_Cfam_GSD_1.0

Fnta
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	45,764,313 - 45,791,302 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936570	362,655 - 389,649 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FNTA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	11,928,358 - 11,951,684 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	11,928,327 - 11,953,139 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

FNTA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	41,057,798 - 41,088,210 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	41,057,603 - 41,087,705 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	681,570 - 712,699 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Fnta
75 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	43
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000019594
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat

Markers in Region

D8Rck2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,083,188 - 66,083,420 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	70,854,453 - 70,854,684	NCBI	Rnor6.0
Rnor_5.0	16	70,518,791 - 70,519,022	UniSTS	Rnor5.0
RGSC_v3.4	16	70,458,162 - 70,458,393	UniSTS	RGSC3.4
Celera	16	63,994,192 - 63,994,423	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

RH94481

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,083,261 - 66,083,431 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	70,854,526 - 70,854,695	NCBI	Rnor6.0
Rnor_5.0	16	70,518,864 - 70,519,033	UniSTS	Rnor5.0
RGSC_v3.4	16	70,458,235 - 70,458,404	UniSTS	RGSC3.4
Celera	16	63,994,265 - 63,994,434	UniSTS
RH 3.4 Map	16	622.7	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

BI274352

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,083,057 - 66,083,262 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	70,854,322 - 70,854,526	NCBI	Rnor6.0
Rnor_5.0	16	70,518,660 - 70,518,864	UniSTS	Rnor5.0
RGSC_v3.4	16	70,458,031 - 70,458,235	UniSTS	RGSC3.4
Celera	16	63,994,061 - 63,994,265	UniSTS
RH 3.4 Map	16	620.8	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

BI282482

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,083,250 - 66,083,402 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	70,854,515 - 70,854,666	NCBI	Rnor6.0
Rnor_5.0	16	70,518,853 - 70,519,004	UniSTS	Rnor5.0
RGSC_v3.4	16	70,458,224 - 70,458,375	UniSTS	RGSC3.4
Celera	16	63,994,254 - 63,994,405	UniSTS
RH 3.4 Map	16	620.3	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085758	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M81225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019594 ⟹ ENSRNOP00000019594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	66,065,132 - 66,083,460 (+)	Ensembl
Rnor_6.0 Ensembl	16	70,834,957 - 70,854,724 (+)	Ensembl

RefSeq Acc Id:

NM_012847 ⟹ NP_036979

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	72,767,864 - 72,786,193 (+)	NCBI
mRatBN7.2	16	66,065,131 - 66,083,460 (+)	NCBI
Rnor_6.0	16	70,834,957 - 70,854,724 (+)	NCBI
Rnor_5.0	16	70,499,605 - 70,519,062 (+)	NCBI
RGSC_v3.4	16	70,440,340 - 70,458,433 (+)	RGD
Celera	16	63,976,260 - 63,994,463 (+)	RGD

Sequence:

show sequence

GCGGGCCGCGGAGGGGGCGGGGCTCCACCACCACCTCAGCTGCGGACGGAGGCGAGATGGCGGC
CACTGAGGGGGTCGGGGAATCTGCGCCAGGCGGTGAGCCGGGACAGCCAGAGCAGCCGCCGCCC
CCGCCTCCTCCGCCGCCAGCACAGCAGCCGCAGGAAGAAGAGATGGCGGCCGAGGCCGGGGAAG
CAGCGGCGTCCCCTATGGACGACGGGTTTCTGAGCCTGGACTCGCCCACCTATGTCTTGTACAG
GGACAGGGCAGAGTGGGCTGACATAGACCCAGTGCCCCAGAATGATGGCCCCAGTCCAGTGGTC
CAGATCATCTACAGTGAAAAGTTTAGAGACGTCTATGATTACTTCCGAGCTGTTCTGCAGCGCG
ATGAAAGAAGCGAACGAGCCTTTAAGCTCACTCGAGATGCTATTGAGTTAAACGCAGCCAACTA
TACGGTGTGGCATTTTCGGAGAGTTCTCTTGAGGTCGCTTCAGAAGGATCTGCAAGAAGAAATG
AACTACATCATCGCAATAATTGAGGAACAGCCCAAAAACTATCAAGTTTGGCACCATAGGAGAG
TATTAGTGGAGTGGCTGAAAGATCCTTCTCAAGAGCTCGAGTTCATCGCCGATATCCTTAATCA
GGATGCAAAGAATTACCATGCCTGGCAGCATCGACAGTGGGTCATTCAGGAGTTTCGACTTTGG
GATAATGAGCTGCAGTATGTGGACCAGCTTCTCAAAGAGGATGTGAGAAATAACTCTGTGTGGA
ACCAAAGACACTTCGTCATTTCTAATACCACTGGCTACAGTGATCGCGCTGTGTTGGAGAGAGA
AGTCCAATATACTCTGGAAATGATCAAATTAGTGCCACACAATGAGAGTGCGTGGAACTACTTG
AAAGGGATTTTGCAGGACCGTGGTCTTTCCAGATACCCTAATCTATTAAACCAGTTGCTTGATT
TACAACCAAGTCACAGCTCCCCCTACCTAATTGCCTTTCTTGTGGATATCTATGAAGACATGCT
GGAAAACCAGTGTGACAACAAGGAGGACATTCTTAATAAAGCACTAGAGTTATGTGAGATTCTA
GCTAAAGAAAAGGACACTATAAGAAAGGAATATTGGAGATATATTGGACGGTCCCTCCAGAGTA
AACACAGCAGAGAAAGTGACATACCGGCGAGTGTATAGCAGCAAGAGCGGCTGGAAGAAGTGGA
CAATGCTTTCTAAGGCCTCTTATTCGGGAGTGTAGAGCGGTTAGAGCGGTCATCTCATGCCTGT
GAGCTAACGTTGTCCAGGTGCTGTTTCTAACAAGAACTAAGGATGACTCCTGTGTCTGACGCTG
TTCAGACTAGCTAAGAGTCGATTTCCTAAAGCAAGGTCATTGGAGGGGAGGGTGAAGAAAACTT
TCCCGTAAAGGAACTACTGCTTTTGTAGTCTTCCCAACATTTAATCCAATCCTGTAGAATCAGC
ATCTCCTGAAAGACATGGTGCACGGCTGTGTGCTGGGCGTGGCTAAGGGCAGCTGTGTCATGGG
TTTGCAGTCATGGGAACCTCGGAGCGCTGCCCGGGACTGCATTGATGATTAGGGCTGCTGGCCT
CACCCACAGGATCTTGCTATCACTGTAACCAACTAATGCCAAAAGAAAGGTTTTATAATAAAAT
CACATTATCTACAAAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_036979	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41833	(Get FASTA)	NCBI Sequence Viewer
	AAH85758	(Get FASTA)	NCBI Sequence Viewer
	EDM09075	(Get FASTA)	NCBI Sequence Viewer
	EDM09076	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019594.2
GenBank Protein	Q04631	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036979 ⟸ NM_012847

- UniProtKB:

Q04631 (UniProtKB/Swiss-Prot), Q5RKJ4 (UniProtKB/TrEMBL), F7FMZ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDSPTYV
LYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNA
ANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADI
LNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVL
EREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRESDIPASV

hide sequence

Ensembl Acc Id:

ENSRNOP00000019594 ⟸ ENSRNOT00000019594

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q04631-F1-model_v2	AlphaFold	Q04631	1-377	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700161

Promoter ID:

EPDNEW_R10685

Type:

multiple initiation site

Name:

Fnta_1

Description:

farnesyltransferase, CAAX box, alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	70,834,990 - 70,835,050	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2625	AgrOrtholog
BioCyc Gene	G2FUF-10987	BioCyc
Ensembl Genes	ENSRNOG00000014462	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019594.5	UniProtKB/TrEMBL
Gene3D-CATH	Protein prenylyltransferase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7189836	IMAGE-MGC_LOAD
InterPro	Prenyl_trans_a	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25318	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93617	IMAGE-MGC_LOAD
NCBI Gene	25318	ENTREZGENE
PANTHER	PROTEIN FARNESYLTRANSFERASE ALPHA SUBUNIT/RAB GERANYLGERANYL TRANSFERASE ALPHA SUBUNIT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN FARNESYLTRANSFERASE/GERANYLGERANYLTRANSFERASE TYPE-1 SUBUNIT ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PPTA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fnta	PhenoGen
PROSITE	PFTA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014462	RatGTEx
Superfamily-SCOP	Protein prenylyltransferase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204731
UniProt	A6IVZ7_RAT	UniProtKB/TrEMBL
	F7FMZ5	ENTREZGENE, UniProtKB/TrEMBL
	FNTA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5RKJ4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-03-29	Fnta	farnesyltransferase, CAAX box, subunit alpha	Fnta	farnesyltransferase, CAAX box, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Fnta	farnesyltransferase, CAAX box, alpha		Farnesyltransferase, subunit alpha	Name updated	625702	APPROVED
2002-06-10	Fnta	Farnesyltransferase, subunit alpha			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_drugs	inhibitors of farnesyltransferase cause tumour regression in animals and are currently being evaluated in clinical trails for the treatment of human cancer	625725
gene_function	catalyzes the formation of thioether linkages between the C1 atom of farnesyl (15-carbon ) isoprenoid lipids and cysteine residues at or near the carboxy-terminus of protein acceptors	625725
gene_protein	377 amino acids	728420

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar