Fh (fumarate hydratase) - Rat Genome Database

Name: Fh
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Fh (fumarate hydratase) Rattus norvegicus

Analyze

Symbol:

Name:

fumarate hydratase

RGD ID:

2614

Description:

Enables fumarate hydratase activity. Involved in fumarate metabolic process; malate metabolic process; and tricarboxylic acid cycle. Predicted to be located in cytosol; nucleus; and site of double-strand break. Predicted to be part of tricarboxylic acid cycle enzyme complex. Predicted to be active in mitochondrial matrix. Human ortholog(s) of this gene implicated in fumarase deficiency and lung non-small cell carcinoma. Orthologous to human FH (fumarate hydratase); PARTICIPATES IN altered citric acid cycle pathway; citric acid cycle pathway; fumaric aciduria pathway; INTERACTS WITH (+)-schisandrin B; (R)-adrenaline; 1,2,4-trimethylbenzene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fh1; fumarase; fumarate hydratase 1; fumarate hydratase, mitochondrial; MGC105468

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FH (fumarate hydratase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fh1 (fumarate hydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fh (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FH (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FH (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fh (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FH (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FH (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fh (fumarate hydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	INHBB (inhibin subunit beta B)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Fh1 (fumarate hydratase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FH (fumarate hydratase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fh (fumarate hydratase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	FUM1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fum1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fum2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fum3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Fum4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	fum-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Fh^em1

Genetic Models:

SD-Fh^em1+/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	90,056,565 - 90,082,450 (-)	NCBI		GRCr8
mRatBN7.2	13	87,524,331 - 87,550,215 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	87,524,337 - 87,550,266 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	90,024,127 - 90,050,089 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	91,424,397 - 91,450,349 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	88,603,544 - 88,629,509 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	93,651,486 - 93,677,371 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	93,651,484 - 93,677,377 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	98,116,496 - 98,142,636 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	91,329,837 - 91,355,722 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	91,518,725 - 91,544,617 (-)	NCBI
Celera	13	87,123,119 - 87,148,786 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

B-lymphoblastic leukemia/lymphoma (ISO)

breast cancer (ISO)

COVID-19 (ISO)

fumarase deficiency (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

hepatoblastoma (ISO)

hepatocellular carcinoma (ISO)

Hereditary Leiomyomatosis and Renal Cell Cancer (ISO)

Hereditary Neoplastic Syndromes (ISO)

leiomyoma cutis (ISO)

lung non-small cell carcinoma (ISO)

microcephaly (ISO)

Neurodevelopmental Disorders (ISO)

ovarian cancer (ISO)

parathyroid carcinoma (ISO)

renal cell carcinoma (ISO)

uterine fibroid (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

(R)-adrenaline (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

7H-xanthine (EXP)

8-Epidiosbulbin E acetate (ISO)

9H-xanthine (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

atrazine (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

C60 fullerene (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

clomipramine (EXP)

cobalt dichloride (ISO)

cocaine (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

erastin (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

flavonoids (EXP)

folic acid (ISO)

formaldehyde (ISO)

gold atom (ISO)

gold(0) (ISO)

hydrogen peroxide (ISO)

indometacin (EXP,ISO)

inulin (ISO)

irinotecan (EXP)

isotretinoin (ISO)

ivermectin (ISO)

lamivudine (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

Macrosphelide A (ISO)

methapyrilene (EXP)

methidathion (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

morphine (EXP)

Nor-9-carboxy-delta9-THC (ISO)

olaparib (ISO)

ouabain (ISO)

ozone (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phlorizin (ISO)

pinosylvin (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

streptozocin (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

trans-pinosylvin (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

vorinostat (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA damage response (ISO,ISS)

DNA repair (IEA)

fumarate metabolic process (IBA,ISO,ISS,TAS)

homeostasis of number of cells within a tissue (ISO)

malate metabolic process (IBA,ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

positive regulation of double-strand break repair via nonhomologous end joining (ISO,ISS)

regulation of arginine metabolic process (ISO,ISS)

tricarboxylic acid cycle (IBA,IEA,ISO)

urea cycle (ISO,ISS)

Cellular Component

chromosome (IEA)

cytoplasm (ISO)

cytosol (IEA,ISO)

mitochondrial matrix (ISO)

mitochondrion (IBA,ISO)

nucleus (IEA,ISO)

site of double-strand break (ISO)

Molecular Function

fumarate hydratase activity (IBA,IMP,ISO,ISS)

histone binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered citric acid cycle pathway (ISO)

citric acid cycle pathway (ISO)

fumaric aciduria pathway (ISO)

mitochondrial complex II deficiency pathway (ISO)

pyruvate dehydrogenase E2 deficiency pathway (ISO)

pyruvate dehydrogenase E3 deficiency pathway (ISO)

renal cell carcinoma pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal kidney morphology (IMP)

abnormal lymphocyte morphology (IMP)

decreased blood uric acid level (IMP)

decreased eosinophil cell number (IMP)

decreased hematocrit (IMP)

decreased leukocyte cell number (IMP)

decreased litter size (IMP)

decreased lymphocyte cell number (IMP)

decreased monocyte cell number (IMP)

embryonic lethality (IMP)

increased blood urea nitrogen level (IMP)

increased body weight (IMP)

increased circulating creatinine level (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Genetic variants in genes of tricarboxylic acid cycle key enzymes are associated with prognosis of patients with non-small cell lung cancer.	Guo X, etal., Lung Cancer. 2015 Feb;87(2):162-8. doi: 10.1016/j.lungcan.2014.12.005. Epub 2014 Dec 18.
4.	Preparation and properties of mitochondria derived from synaptosomes.	Lai JC and Clark JB, Biochem J. 1976 Feb 15;154(2):423-32.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	HIF and fumarate hydratase in renal cancer.	Sudarshan S, etal., Br J Cancer. 2007 Feb 12;96(3):403-7. Epub 2007 Jan 9.
11.	Rat liver mitochondrial and cytosolic fumarases with identical amino acid sequences are encoded from a single gene.	Suzuki T, etal., J Biol Chem 1989 Feb 15;264(5):2581-6.
12.	Novel mutations in FH and expansion of the spectrum of phenotypes expressed in families with hereditary leiomyomatosis and renal cell cancer.	Wei MH, etal., J Med Genet. 2006 Jan;43(1):18-27. Epub 2005 Jun 3.
13.	Adipose-Specific Deficiency of Fumarate Hydratase in Mice Protects Against Obesity, Hepatic Steatosis, and Insulin Resistance.	Yang H, etal., Diabetes. 2016 Nov;65(11):3396-3409. doi: 10.2337/db16-0136. Epub 2016 Aug 23.
14.	Generation of TALEN-mediated FH knockout rat model.	Yu D, etal., Oncotarget. 2016 Sep 20;7(38):61656-61669. doi: 10.18632/oncotarget.11429.

Additional References at PubMed

PMID:8200987	PMID:12477932	PMID:14651853	PMID:17111171	PMID:17418408	PMID:18614015	PMID:20231875	PMID:20458337	PMID:20833797	PMID:21498518	PMID:22507198	PMID:23376485
PMID:23643539	PMID:26237645	PMID:27037871	PMID:28754823	PMID:29456767	PMID:30718813	PMID:30761759	PMID:31235845	PMID:33755527

Genomics

Comparative Map Data

Fh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	90,056,565 - 90,082,450 (-)	NCBI		GRCr8
mRatBN7.2	13	87,524,331 - 87,550,215 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	87,524,337 - 87,550,266 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	90,024,127 - 90,050,089 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	91,424,397 - 91,450,349 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	88,603,544 - 88,629,509 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	93,651,486 - 93,677,371 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	93,651,484 - 93,677,377 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	98,116,496 - 98,142,636 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	91,329,837 - 91,355,722 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	91,518,725 - 91,544,617 (-)	NCBI
Celera	13	87,123,119 - 87,148,786 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

FH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	241,497,603 - 241,519,755 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	241,497,511 - 241,519,799 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	241,660,903 - 241,683,055 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	239,727,526 - 239,749,677 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	237,986,946 - 238,009,095	NCBI
Celera	1	214,915,854 - 214,938,092 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI
HuRef	1	212,119,119 - 212,141,338 (-)	NCBI		HuRef
CHM1_1	1	242,933,564 - 242,955,781 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	240,909,033 - 240,931,170 (-)	NCBI		T2T-CHM13v2.0

Fh1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	175,428,944 - 175,453,201 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	175,427,940 - 175,453,201 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	175,601,378 - 175,625,635 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	175,600,374 - 175,625,635 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	177,531,509 - 177,555,766 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	177,438,053 - 177,462,253 (-)	NCBI		MGSCv36	mm8
Celera	1	182,687,061 - 182,711,324 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	81.58	NCBI

Fh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	10,535,323 - 10,561,627 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	10,535,801 - 10,558,649 (+)	NCBI	ChiLan1.0	ChiLan1.0

FH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	7,627,088 - 7,649,060 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	7,851,062 - 7,873,025 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	217,059,847 - 217,081,795 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	222,041,142 - 222,063,271 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	222,041,142 - 222,064,212 (-)	Ensembl	panpan1.1		panPan2

FH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	32,900,250 - 32,927,436 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	32,901,586 - 32,927,412 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	32,378,016 - 32,404,992 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	32,726,854 - 32,753,856 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	32,726,854 - 32,753,869 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	32,562,040 - 32,588,973 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	32,586,108 - 32,613,094 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	32,834,235 - 32,861,236 (-)	NCBI		UU_Cfam_GSD_1.0

Fh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	45,782,142 - 45,811,186 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936526	8,935,991 - 8,965,367 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936526	8,936,096 - 8,965,155 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	12,404,176 - 12,431,824 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	12,404,143 - 12,431,843 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	14,852,719 - 14,879,014 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	78,576,931 - 78,599,998 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	78,575,300 - 78,599,972 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	80,709,772 - 80,732,613 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	11,856,884 - 11,887,066 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	11,861,537 - 11,886,154 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fh
150 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	76
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000004917
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat

Genetic Models

This gene Fh is modified in the following models/strains:

SD-Fh^em1+/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	40	11	8
Low											1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC119639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000004917 ⟹ ENSRNOP00000004917

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	87,524,337 - 87,550,266 (-)	Ensembl
Rnor_6.0 Ensembl	13	93,651,484 - 93,677,377 (-)	Ensembl

RefSeq Acc Id:

NM_017005 ⟹ NP_058701

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	90,056,565 - 90,082,450 (-)	NCBI
mRatBN7.2	13	87,524,331 - 87,550,215 (-)	NCBI
Rnor_6.0	13	93,651,486 - 93,677,371 (-)	NCBI
Rnor_5.0	13	98,116,496 - 98,142,636 (-)	NCBI
RGSC_v3.4	13	91,329,837 - 91,355,722 (-)	RGD
Celera	13	87,123,119 - 87,148,786 (-)	RGD

Sequence:

show sequence

CGTACAGCAGCACCATGAACCGCGCATTCTGTCTCCTCGCTCGCTCGCGTCGCTTCCCGCGGGT
CCCCTCCGCCGGTGCTGTATTGTCAGGGGAAGCGGCCACCCTCCCACGGTGTGCTCCGAACGTC
GTGCGAATGGCAAGCCAAAATTCCTTCCGTATAGAATACGACACCTTTGGTGAACTGAAGGTCC
CAACCGATAAGTATTATGGTGCTCAGACTGTAAGATCTACGATGAACTTTAAGATTGGAGGTGC
GACGGAGAGAATGCCAATCCCAGTCATTAAAGCATTTGGCATCTTGAAGCGAGCTGCTGCTGAA
GTGAACCAGGAGTATGGTCTCGATCCCAAGATTGCTAGTGCAATAATGAAGGCCGCAGATGAGG
TAGCTGAAGGTAAATTAAACGATCACTTTCCTCTGGTGGTATGGCAGACTGGGTCAGGAACCCA
GACGAACATGAATGTAAATGAAGTCATTAGCAACAGGGCAATCGAAATGCTAGGAGGTGAACTT
GGCAGCAAGAAGCCCGTGCACCCCAATGATCACGTTAACAAAAGCCAGAGCTCGAATGACACCT
TCCCCACAGCAATGCACATTGCTGCTGCACTGGAAGTTCACCAGGTCCTGTTGCCAGGATTACA
GAAGCTGCACGATGCCCTCAGTGCAAAATCCAAAGAGTTCGCGCAGGTCATAAAAATTGGGCGG
ACTCATACGCAGGACGCTGTCCCTCTTACTCTTGGACAGGAGTTCAGTGGTTATGTTCAGCAAG
TCCAGTATGCGATGGAGAGGATAAAAGCTGCCATGCCCAGAATCTACGAGCTCGCTGCTGGCGG
CACTGCCGTCGGCACGGGACTAAACACCAGGATCGGCTTCGCAGAAAAGGTGGCTGCAAAAGTC
GCAGCACTCACAGGTTTGCCTTTTGTCACTGCCCCGAATAAGTTTGAAGCTCTGGCCGCTCATG
ATGCTCTGGTGGAGCTTAGTGGAGCCATGAACACTACGGCCTGCAGTCTGATGAAGATTGCCAA
TGACATTCGCTTCCTCGGTTCTGGTCCTCGGTCCGGTTTGGGGGAGCTGATCTTGCCTGAAAAT
GAGCCAGGGAGCAGCATAATGCCAGGAAAGGTGAACCCTACTCAGTGTGAGGCGATGACCATGG
TTGCAGCCCAAGTCATGGGGAATCATGTCGCTGTTACTGTTGGAGGCAGCAATGGACATTTCGA
ACTGAATGTTTTTAAACCGATGATGATTAAGAATGTGTTGCACTCAGCCAGGCTACTGGGAGAT
GCTTCAGTGTCCTTCACAGAGAACTGTGTGGTAGGGATCCAGGCCAACACAGAGAGGATCAACA
AGCTAATGAACGAGTCTTTAATGTTGGTTACAGCTCTTAATCCGCATATAGGGTATGACAAAGC
AGCGAAGATTGCCAAGACTGCACACAAGAACGGATCAACCTTAAAGGAAACGGCTATTGAACTT
GGCTATCTCACAGCAGAGCAGTTTGATGAGTGGGTGAAACCCAAGGACATGCTGGGTCCAAAGT
GACTTAAATTTATATTAAAATAAACATGTATGAAATTTAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058701	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41177	(Get FASTA)	NCBI Sequence Viewer
	AAH87598	(Get FASTA)	NCBI Sequence Viewer
	EDL94769	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004917
	ENSRNOP00000004917.3
GenBank Protein	P14408	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058701 ⟸ NM_017005
- Peptide Label:	precursor
- UniProtKB:	P14408 (UniProtKB/Swiss-Prot), Q5M964 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNRAFCLLARSRRFPRVPSAGAVLSGEAATLPRCAPNVVRMASQNSFRIEYDTFGELKVPTDKY YGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQEYGLDPKIASAIMKAADEVAEGK LNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAM HIAAALEVHQVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLTLGQEFSGYVQQVQYAM ERIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVE LSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQV MGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNE SLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK hide sequence

RefSeq Acc Id:

ENSRNOP00000004917 ⟸ ENSRNOT00000004917

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P14408-F1-model_v2	AlphaFold	P14408	1-507	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699039

Promoter ID:

EPDNEW_R9564

Type:

initiation region

Name:

Fh_1

Description:

fumarate hydratase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	93,677,377 - 93,677,437	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2614	AgrOrtholog
BioCyc Gene	G2FUF-17233	BioCyc
BioCyc Pathway	PWY-5690 [TCA cycle II (plants and fungi)]	BioCyc
BioCyc Pathway Image	PWY-5690	BioCyc
Ensembl Genes	ENSRNOG00000003653	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004917	ENTREZGENE
	ENSRNOT00000004917.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.275.10	UniProtKB/Swiss-Prot
	Fumarase/aspartase (C-terminal domain)	UniProtKB/Swiss-Prot
	Fumarase/aspartase (Central domain)	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7311498	IMAGE-MGC_LOAD
InterPro	Fum_hydII	UniProtKB/Swiss-Prot
	Fumarase/histidase_N	UniProtKB/Swiss-Prot
	Fumarase_C_C	UniProtKB/Swiss-Prot
	Fumarate_lyase_CS	UniProtKB/Swiss-Prot
	Fumarate_lyase_fam	UniProtKB/Swiss-Prot
	Fumarate_lyase_N	UniProtKB/Swiss-Prot
	L-Aspartase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:24368	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105468	IMAGE-MGC_LOAD
NCBI Gene	24368	ENTREZGENE
PANTHER	FUMARATE HYDRATASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR11444	UniProtKB/Swiss-Prot
Pfam	FumaraseC_C	UniProtKB/Swiss-Prot
	Lyase_1	UniProtKB/Swiss-Prot
PhenoGen	Fh	PhenoGen
PRINTS	FUMRATELYASE	UniProtKB/Swiss-Prot
PROSITE	FUMARATE_LYASES	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003653	RatGTEx
Superfamily-SCOP	SSF48557	UniProtKB/Swiss-Prot
UniProt	FUMH_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5M964	ENTREZGENE
UniProt Secondary	Q5M964	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-01-17	Fh	fumarate hydratase	Fh1	fumarate hydratase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Fh1	fumarate hydratase 1	Fh	Fumarate hydratase	Symbol and Name updated	625702	APPROVED
2002-06-10	Fh	Fumarate hydratase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in liver	632664
gene_other	possibly both the isozymes are encoded from the same mRNA	632664

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways

Mammalian Phenotype