Advanced Search (OLGA)

Gene: Ctxn1 (cortexin 1) Rattus norvegicus

Analyze

Symbol:

Ctxn1

Name:

cortexin 1

RGD ID:

2449

Description:

Predicted to be located in membrane. Orthologous to human CTXN1 (cortexin 1); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-terminal binding protein 1; cortexin; cortexin-1; Ctxn

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTXN1 (cortexin 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ctxn1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ctxn1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTXN1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTXN1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ctxn1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CTXN1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CTXN1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ctxn1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ctxn1 (cortexin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CTXN1 (cortexin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ctxn1 (cortexin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ctxn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	7,408,308 - 7,409,919 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	7,408,309 - 7,409,919 (-)	Ensembl				GRCr8
mRatBN7.2	12	2,610,465 - 2,612,076 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	12	3,258,542 - 3,260,151 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	3,882,133 - 3,883,742 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	2,645,147 - 2,646,758 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	2,534,212 - 2,535,823 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	2,534,212 - 2,535,822 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	4,687,159 - 4,688,770 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	1,531,822 - 1,533,433 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	4,425,998 - 4,427,609 (-)	NCBI		Celera
RGSC_v3.1	12	1,531,821 - 1,533,432 (+)	NCBI
Cytogenetic Map	12	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,5-hexanedione (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

decabromodiphenyl ether (EXP)

fipronil (EXP)

flavonoids (EXP)

folic acid (ISO)

gentamycin (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

paracetamol (ISO)

PCB138 (EXP,ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

toluene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of cortexin: a novel, neuron-specific, 82-residue membrane protein enriched in rodent cerebral cortex.	Coulter PM 2nd, etal., J Neurochem 1993 Aug;61(2):756-9.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548

Genomics

Comparative Map Data

Ctxn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	7,408,308 - 7,409,919 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	7,408,309 - 7,409,919 (-)	Ensembl				GRCr8
mRatBN7.2	12	2,610,465 - 2,612,076 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	12	3,258,542 - 3,260,151 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	3,882,133 - 3,883,742 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	2,645,147 - 2,646,758 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	2,534,212 - 2,535,823 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	2,534,212 - 2,535,822 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	4,687,159 - 4,688,770 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	1,531,822 - 1,533,433 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	4,425,998 - 4,427,609 (-)	NCBI		Celera
RGSC_v3.1	12	1,531,821 - 1,533,432 (+)	NCBI
Cytogenetic Map	12	p12	NCBI

CTXN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	7,924,491 - 7,926,135 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	7,924,491 - 7,926,135 (-)	Ensembl			hg38	GRCh38
GRCh37	19	7,989,376 - 7,991,020 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	7,895,384 - 7,897,029 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	7,895,383 - 7,897,029	NCBI
Celera	19	7,860,583 - 7,862,253 (-)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	7,659,679 - 7,660,245 (-)	NCBI		HuRef
CHM1_1	19	7,988,850 - 7,990,520 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	7,925,445 - 7,927,089 (-)	NCBI		T2T-CHM13v2.0

Ctxn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	4,307,646 - 4,309,274 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	4,307,660 - 4,309,274 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	4,257,646 - 4,259,274 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	4,257,660 - 4,259,274 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	4,257,646 - 4,259,274 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	4,257,660 - 4,259,210 (-)	NCBI		MGSCv36	mm8
Celera	8	4,458,235 - 4,459,863 (-)	NCBI		Celera
Cytogenetic Map	8	A1.1	NCBI
cM Map	8	1.99	NCBI

Ctxn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955563	1,343,208 - 1,344,056 (+)	Ensembl
ChiLan1.0	NW_004955563	1,343,212 - 1,344,056 (+)	NCBI	ChiLan1.0	ChiLan1.0

CTXN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	12,607,274 - 12,608,922 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	11,724,473 - 11,726,116 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	7,225,738 - 7,227,412 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	8,078,377 - 8,100,527 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	8,079,181 - 8,079,429 (-)	Ensembl			panPan2	panpan1.1

CTXN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	52,613,314 - 52,614,159 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	52,613,314 - 52,614,159 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	52,415,671 - 52,416,517 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	53,141,456 - 53,142,308 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	53,141,456 - 53,142,308 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	52,344,758 - 52,345,604 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	52,789,219 - 52,790,083 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	53,020,750 - 53,021,592 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ctxn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	212,932,894 - 212,934,509 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	4,900,302 - 4,901,904 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	4,898,888 - 4,901,904 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CTXN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	71,288,242 - 71,289,949 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	71,287,935 - 71,289,964 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	71,688,693 - 71,690,356 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTXN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	7,375,855 - 7,377,536 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	7,376,664 - 7,376,912 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666081	436,768 - 438,459 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ctxn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	887,005 - 888,430 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	887,006 - 888,524 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ctxn1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	2,390,844 - 2,392,449 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ctxn1
38 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	314
Count of miRNA genes:	177
Interacting mature miRNAs:	208
Transcripts:	ENSRNOT00000001399
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
724526	Uae3	Urinary albumin excretion QTL 3	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	12	1	15486827	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1357337	Gluco3	Glucose level QTL 3		0.0004	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	12	1	16966671	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
61334	Gluco17	Glucose level QTL 17	6.3		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	12	1	16966671	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1600391	Edcs2	Endometrial carcinoma susceptibility QTL2	3.5	0.01	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	12	1	11869600	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat

Markers in Region

RH129998

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	2,610,626 - 2,610,816 (-)	MAPPER	mRatBN7.2
Rnor_6.0	12	2,535,472 - 2,535,661	NCBI	Rnor6.0
Rnor_5.0	12	4,688,419 - 4,688,608	UniSTS	Rnor5.0
RGSC_v3.4	12	1,533,082 - 1,533,271	UniSTS	RGSC3.4
Celera	12	4,426,160 - 4,426,349	UniSTS
Cytogenetic Map	12	p12	UniSTS

RH126119

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	2,612,618 - 2,612,839 (-)	MAPPER	mRatBN7.2
Rnor_6.0	12	2,533,450 - 2,533,669	NCBI	Rnor6.0
Rnor_5.0	12	4,686,397 - 4,686,616	UniSTS	Rnor5.0
RGSC_v3.4	12	1,531,060 - 1,531,279	UniSTS	RGSC3.4
Celera	12	4,428,152 - 4,428,371	UniSTS
Cytogenetic Map	12	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	157	91	90	59	75	59	6	334	171	7	140	80	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CK841592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY309362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L15011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001399 ⟹ ENSRNOP00000001399

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	2,534,212 - 2,535,822 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000132665 ⟹ ENSRNOP00000104095

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	7,408,309 - 7,409,919 (-)	Ensembl

RefSeq Acc Id:

NM_001109935 ⟹ NP_001103405

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	7,408,308 - 7,409,919 (-)	NCBI
mRatBN7.2	12	2,610,465 - 2,612,076 (-)	NCBI
Rnor_6.0	12	2,534,212 - 2,535,823 (+)	NCBI
Rnor_5.0	12	4,687,159 - 4,688,770 (+)	NCBI
RGSC_v3.4	12	1,531,822 - 1,533,433 (+)	RGD
Celera	12	4,425,998 - 4,427,609 (-)	RGD

Sequence:

show sequence

GAACAGCCGCGGCGGCCCGGCTGGCGCGCGGCTCTCCATCCTCGCTCGGTCTCCACCGCTCCAG
GGGCGGATGGGGTGGGCTGAGCCGGGGCTGCCACAGCCTCCGCCACTACCGCCGCCACCCGGGG
AAGACCAGAACAAAGCAGCGCACGAGTCCCAAGAAAGAGAAAGAGAGAGGGGCTGCAGGGCGGC
CGGTCCCCGTCTAGGACCAAGGAGCGCGGCGATGTGAGCTATGAGTGCGCCGTGGACACTGTCA
CCGGAGCCGCTGCCGCCATCGACGGGGCCTCCGGTGGGCGCGGGCCTGGACGTCGAGCAACGCA
CGGTGTTCGCCTTCGTGCTCTGCCTGCTCGTGGTGTTGGTTCTGTTGATGGTGCGCTGTGTACG
CATACTGCTAGACCCCTACAGCCGCATGCCCGCCTCGTCCTGGACCGACCACAAGGAGGCGCTT
GAACGTGGGCAGTTCGACTATGCGTTGGTGTGATGAGGAACCAGTCCCGGGCAGGTCCTTAGAG
AGATCCCACAAGGGTCGGCCCCGTGGAGGGGTGCCCCCAGCCTGGACTGCGCTCAGGGTTATGC
CTAGATGCCCTAGCTCAGAGTTGAGGGCGTTCGGAGAAGTCCAGCCCTTACCCACCTTAACCAC
CCATCTTCCATCCTGGCCAGGCCAGAACCCCCCACCTGGTGCCTTTATCTGCCCTGTCCCCTTC
TCTACACACTCATCCTCAATGCTGATCCCTCAACACTGAATCCCTAGTGAGCGAAGCACCCGGC
ACCAACCTCAGCCTTCCCCAACAACCAGGCATGTTACATCCTTTCCTGGGAATGCGGACTCCTC
TTATCTCTTATTCCTTTCCCCCTGTTATGGTCATCAGCAGTGTCAGTGCACTTCTTGAGTTCTG
GCCCTGGCAGGCAGGCTCTCTTCGACTCACATTGGACACTGCCTACCTATAATGCACGGTACAG
CCTGCCCCAGAGACAGACCCCAAAACTCCACCATGGCTGCTGCTTGTGTTGATAATGTCTGGCA
CTTTATGTGCAGGAGTACAAGGAGGCTCATTCCCTTCCCAGACCCGGCCCCAGCACAGGTTAGA
GTGCCTTTCCTTTGCCCCACCTCTCCTATCTCCCCCCATGTCCCCATGCCCTTCCCTGCCTATC
ACACCTCCCTGGCTCTGAACGGTGGTGATGATAATAAAAACTATTATTGAGTGCTTAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001103405	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000104095
GenBank Protein	P41237	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001103405 ⟸ NM_001109935
- UniProtKB:	P41237 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSAPWTLSPEPLPPSTGPPVGAGLDVEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASS WTDHKEALERGQFDYALV hide sequence

Ensembl Acc Id:

ENSRNOP00000001399 ⟸ ENSRNOT00000001399

Ensembl Acc Id:

ENSRNOP00000104095 ⟸ ENSRNOT00000132665

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P41237-F1-model_v2	AlphaFold	P41237	1-82	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698382

Promoter ID:

EPDNEW_R8906

Type:

initiation region

Name:

Ctxn1_1

Description:

cortexin 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	2,534,252 - 2,534,312	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2449	AgrOrtholog
BioCyc Gene	G2FUF-20348	BioCyc
Ensembl Genes	ENSRNOG00000001057	Ensembl
	ENSRNOG00000073687	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000132665	ENTREZGENE
InterPro	Cortexin	UniProtKB/Swiss-Prot
KEGG Report	rno:29145	UniProtKB/Swiss-Prot
NCBI Gene	29145	ENTREZGENE
PANTHER	CORTEXIN-1	UniProtKB/Swiss-Prot
	PTHR16736	UniProtKB/Swiss-Prot
Pfam	Cortexin	UniProtKB/Swiss-Prot
PhenoGen	Ctxn1	PhenoGen
RatGTEx	ENSRNOG00000001057	RatGTEx
	ENSRNOG00000073687	RatGTEx
UniProt	CTXN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-15	Ctxn1	cortexin 1	Ctxn	cortexin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ctxn	cortexin			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression is high in cortex	69824
gene_expression	brain-specific expression	69824
gene_expression	high expression levels in fetal brain, peaking in post-natal brain	69824
gene_expression	expressed in neurons, but not in white matter or hindbrain cells	69824
gene_homology	highly homologous to mouse cortexin	69824
gene_process	may regulate developing and mature cortical neurons	69824

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message