Advanced Search (OLGA)

Gene: Cma1 (chymase 1) Rattus norvegicus

Analyze

Symbol:

Cma1

Name:

chymase 1

RGD ID:

2365

Description:

Enables peptide binding activity and serine-type endopeptidase activity. Involved in several processes, including cellular response to glucose stimulus; midbrain development; and positive regulation of angiogenesis. Located in extracellular region. Biomarker of renovascular hypertension. Human ortholog(s) of this gene implicated in asthma; atopic dermatitis; hypertrophic cardiomyopathy; and sarcoidosis. Orthologous to human CMA1 (chymase 1); PARTICIPATES IN angiotensin II signaling pathway; renin-angiotensin cascade pathway; INTERACTS WITH adefovir; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-chymase; chymase; chymase 1 mast cell; chymase 1, mast cell; mast cell protease 3; mast cell protease 5; mast cell protease III; MCP3P; Mcpt5; rMCP-3; rMCP-5; rMCP-III

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CMA1 (chymase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cma1 (chymase 1, mast cell)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CMA1 (chymase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CMA1 (chymase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CMA1 (chymase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cma1 (chymase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMPRSS11D (transmembrane serine protease 11D)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CMA1 (chymase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cma1 (chymase 1, mast cell)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-212d10.1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gzm3.2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG18420	Alliance	DIOPT (InParanoid\|OMA)
Drosophila melanogaster (fruit fly):	CG33458	Alliance	DIOPT (InParanoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	gzmh	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ctsg	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,387,351 - 33,390,133 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,387,351 - 33,390,133 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,417,451 - 29,420,233 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,417,451 - 29,420,233 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	31,263,077 - 31,265,859 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,410,295 - 32,413,077 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,652,671 - 30,655,453 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,601,037 - 34,603,819 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,601,037 - 34,603,819 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,490,971 - 38,493,753 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	34,083,202 - 34,084,387 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,991,244 - 28,994,014 (-)	NCBI		Celera
RGSC_v3.1	15	34,098,901 - 34,102,176 (-)	NCBI
RH 3.4 Map	15	213.78	RGD
Cytogenetic Map	15	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Anaphylaxis (ISO)

asthma (ISO)

atopic dermatitis (ISO)

Cardiomegaly (ISO)

chronic obstructive pulmonary disease (ISO)

congenital heart disease (ISO)

Experimental Diabetes Mellitus (IEP)

Granuloma (IEP)

hypertension (ISO)

hypertrophic cardiomyopathy (ISO)

interstitial lung disease (ISO)

Left Ventricular Hypertrophy (ISO)

myocarditis (ISO)

pulmonary fibrosis (ISO)

renovascular hypertension (IEP)

sarcoidosis (ISO)

Seasonal Allergic Rhinitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4-hydroxyphenyl retinamide (ISO)

acetohydrazide (ISO)

adefovir (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

carrageenan (EXP)

CGP 52608 (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

dextran sulfate (ISO)

diethylstilbestrol (EXP)

enalapril (EXP)

fenvalerate (EXP)

fructose (ISO)

furan (EXP)

genistein (EXP,ISO)

glucose (ISO)

hexachlorobenzene (EXP)

hydrochlorothiazide (EXP)

indole-3-methanol (EXP)

malathion (ISO)

Mesaconitine (EXP)

methotrexate (ISO)

methoxychlor (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paraquat (EXP,ISO)

PCB138 (ISO)

pentane-2,3-dione (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

testosterone (EXP)

titanium dioxide (EXP,ISO)

topotecan (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

troglitazone (ISO)

verteporfin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basement membrane disassembly (IEA,ISO)

cellular response to glucose stimulus (IEP)

cytokine precursor processing (IEA,ISO)

extracellular matrix disassembly (IEA,ISO)

midbrain development (IEP)

peptide metabolic process (IEP)

positive regulation of angiogenesis (IMP)

protein catabolic process (IDA)

protein maturation (IBA)

protein processing (IDA)

proteolysis (IEA)

regulation of inflammatory response (IEA,ISO)

Cellular Component

cytoplasmic ribonucleoprotein granule (IEA,ISO)

extracellular region (IDA,IEA)

extracellular space (IBA)

secretory granule (IEA,ISO)

Molecular Function

endopeptidase activity (ISO)

hydrolase activity (IEA)

peptidase activity (IEA,NAS)

peptide binding (IEA,IMP)

serine-type endopeptidase activity (IBA,IDA,IEA,IMP,ISO)

serine-type peptidase activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

angiotensin II signaling pathway (IMP)

renin-angiotensin cascade pathway (IEA,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	A protease activated receptor-2 (PAR-2) activating peptide, tc-LIGRLO-NH2, induces protease release from mast cells: role in TNF degradation.	Alshurafa HN, etal., BMC Pharmacol. 2004 Jul 20;4:12.
2.	Mast cell phenotype, location, and activation in severe asthma: data from the severe asthma research program.	Balzar S, etal., Am J Respir Crit Care Med. 2011 Feb 1;183(3):299-309. Epub 2010 Sep 2.
3.	Assessment of bronchial inflammation using an automated cell recognition system based on colour analysis.	Berger P, etal., Eur Respir J. 1999 Dec;14(6):1394-402.
4.	Segmental bronchoprovocation in allergic rhinitis patients affects mast cell and basophil numbers in nasal and bronchial mucosa.	Braunstahl GJ, etal., Am J Respir Crit Care Med. 2001 Sep 1;164(5):858-65.
5.	The Impact of Maternal Separation on the Number of Tyrosine Hydroxylase-Expressing Midbrain Neurons during Different Stages of Ontogenesis.	Chocyk A, etal., Neuroscience. 2011 Mar 8.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Association of mast cells with lung function in chronic obstructive pulmonary disease.	Gosman MM, etal., Respir Res. 2008 Sep 10;9:64.
8.	Increased expression of mast cell chymase in the lungs of patients with congenital heart disease associated with early pulmonary vascular disease.	Hamada H, etal., Am J Respir Crit Care Med. 1999 Oct;160(4):1303-8.
9.	Evidence for a role of mast cells in the evolution to congestive heart failure.	Hara M, etal., J Exp Med. 2002 Feb 4;195(3):375-81.
10.	Enhanced mast cell chymase expression in human idiopathic interstitial pneumonia.	Hirata K, etal., Int J Mol Med. 2007 Apr;19(4):565-70.
11.	Cloning of the cDNA encoding a novel rat mast-cell proteinase, rMCP-3, and its expression in comparison with other rat mast-cell proteinases.	Ide H, etal., Biochem J 1995 Oct 15;311 ( Pt 2):675-80.
12.	Polymorphism of the mast cell chymase gene (CMA1) promoter region: lack of association with asthma but association with serum total immunoglobulin E levels in adult atopic dermatitis.	Iwanaga T, etal., Clin Exp Allergy. 2004 Jul;34(7):1037-42.
13.	Tranilast reduces mesenteric vascular collagen deposition and chymase-positive mast cells in experimental diabetes.	Jones SE, etal., J Diabetes Complications. 2004 Sep-Oct;18(5):309-15.
14.	Extended substrate specificity of rat mast cell protease 5, a rodent alpha-chymase with elastase-like primary specificity.	Karlson U, etal., J Biol Chem. 2003 Oct 10;278(41):39625-31. Epub 2003 Aug 4.
15.	Gene expression of cardiac mast cell chymase and tryptase in a murine model of heart failure caused by viral myocarditis.	Kitaura-Inenaga K, etal., Circ J. 2003 Oct;67(10):881-4.
16.	Human chymase expression in a mice induces mild hypertension with left ventricular hypertrophy.	Koga T, etal., Hypertens Res. 2003 Sep;26(9):759-68.
17.	Chymase gene (CMA1) polymorphisms in Dutch and Japanese sarcoidosis patients.	Kruit A, etal., Respiration. 2006;73(5):623-33. Epub 2006 Jan 27.
18.	Rodent alpha-chymases are elastase-like proteases.	Kunori Y, etal., Eur J Biochem. 2002 Dec;269(23):5921-30.
19.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
20.	Targeting the renin-angiotensin system: what's new?	Leckie BJ Curr Med Chem Cardiovasc Hematol Agents. 2005 Jan;3(1):23-32.
21.	Mast cell chymase induces smooth muscle cell apoptosis by a mechanism involving fibronectin degradation and disruption of focal adhesions.	Leskinen MJ, etal., Arterioscler Thromb Vasc Biol 2003 Feb 1;23(2):238-43.
22.	Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations.	Lutzelschwab C, etal., J Exp Med 1997 Jan 6;185(1):13-29.
23.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
24.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.	Differential accumulation of pulmonary and cardiac mast cell-subsets and eosinophils between fatal anaphylaxis and asthma death: a postmortem comparative study.	Perskvist N and Edston E, Forensic Sci Int. 2007 Jun 14;169(1):43-9. Epub 2006 Nov 1.
26.	Angiotensin-converting enzyme and heart chymase gene polymorphisms in hypertrophic cardiomyopathy.	Pfeufer A, etal., Am J Cardiol. 1996 Aug 1;78(3):362-4.
27.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
28.	GOA pipeline	RGD automated data pipeline
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Inhibition of granuloma-associated angiogenesis by controlling mast cell mediator release: role of mast cell protease-5.	Russo A, etal., Br J Pharmacol. 2005 May;145(1):24-33.
31.	Angiotensin converting enzyme-independent angiotensin ii production by chymase is up-regulated in the ischemic kidney in renovascular hypertension.	Sadjadi J, etal., J Surg Res. 2005 Aug;127(2):65-9.
32.	A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels.	Sharma S, etal., J Hum Genet. 2005;50(6):276-82. Epub 2005 May 28.
33.	High-glucose-induced regulation of intracellular ANG II synthesis and nuclear redistribution in cardiac myocytes.	Singh VP, etal., Am J Physiol Heart Circ Physiol. 2007 Aug;293(2):H939-48. Epub 2007 May 4.
34.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
35.	Association study of mast cell chymase polymorphisms with atopy.	Weidinger S, etal., Allergy. 2005 Oct;60(10):1256-61.

Additional References at PubMed

PMID:1919436	PMID:2266130	PMID:9256427	PMID:9360993	PMID:11502696	PMID:12062105	PMID:16460729	PMID:16690960	PMID:18057996	PMID:18079408	PMID:20551380	PMID:22875344
PMID:26807691	PMID:27068509	PMID:27465904	PMID:27559042	PMID:28748720	PMID:29529050	PMID:31036322

Genomics

Comparative Map Data

Cma1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,387,351 - 33,390,133 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,387,351 - 33,390,133 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,417,451 - 29,420,233 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,417,451 - 29,420,233 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	31,263,077 - 31,265,859 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,410,295 - 32,413,077 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,652,671 - 30,655,453 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,601,037 - 34,603,819 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,601,037 - 34,603,819 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,490,971 - 38,493,753 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	34,083,202 - 34,084,387 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,991,244 - 28,994,014 (-)	NCBI		Celera
RGSC_v3.1	15	34,098,901 - 34,102,176 (-)	NCBI
RH 3.4 Map	15	213.78	RGD
Cytogenetic Map	15	p12	NCBI

CMA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,505,353 - 24,508,265 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,505,353 - 24,508,265 (-)	Ensembl			hg38	GRCh38
GRCh37	14	24,974,559 - 24,977,471 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	24,044,552 - 24,047,311 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	24,044,551 - 24,047,311	NCBI
Celera	14	4,839,478 - 4,842,237 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	5,089,481 - 5,092,240 (-)	NCBI		HuRef
CHM1_1	14	24,973,574 - 24,976,333 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,704,211 - 18,707,123 (-)	NCBI		T2T-CHM13v2.0

Cma1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	56,178,908 - 56,182,132 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	56,178,908 - 56,182,132 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	55,941,451 - 55,944,675 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,941,451 - 55,944,675 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	56,560,288 - 56,563,498 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,895,522 - 54,898,732 (-)	NCBI		MGSCv36	mm8
Celera	14	53,745,166 - 53,748,376 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

CMA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,855,859 - 25,858,985 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	25,072,378 - 25,075,477 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	5,277,269 - 5,280,335 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,400,677 - 23,402,819 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,400,345 - 23,403,548 (-)	Ensembl			panPan2	panpan1.1

CMA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,438,244 - 4,441,189 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,438,244 - 4,441,189 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,359,948 - 4,362,893 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,549,708 - 4,552,661 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,549,715 - 4,552,661 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,239,198 - 4,242,142 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,301,888 - 4,304,834 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,564,103 - 4,567,048 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

CMA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,471,767 - 1,475,062 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,471,725 - 1,474,692 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666036	13,158,008 - 13,161,323 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cma1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,021,959 - 8,024,851 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	8,021,965 - 8,024,763 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Cma1
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	29
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000067539
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH131228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	33,387,456 - 33,387,645 (+)	Marker Load Pipeline
mRatBN7.2	15	29,417,556 - 29,417,745 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,601,143 - 34,601,331	NCBI	Rnor6.0
Rnor_5.0	15	38,491,077 - 38,491,265	UniSTS	Rnor5.0
RGSC_v3.4	15	34,083,308 - 34,083,496	UniSTS	RGSC3.4
Celera	15	28,991,350 - 28,991,538	UniSTS
RH 3.4 Map	15	260.81	UniSTS
Cytogenetic Map	15	p13	UniSTS

RH94861

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	33,387,351 - 33,387,509 (+)	Marker Load Pipeline
mRatBN7.2	15	29,417,451 - 29,417,609 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,601,038 - 34,601,195	NCBI	Rnor6.0
Rnor_5.0	15	38,490,972 - 38,491,129	UniSTS	Rnor5.0
RGSC_v3.4	15	34,083,203 - 34,083,360	UniSTS	RGSC3.4
Celera	15	28,991,245 - 28,991,402	UniSTS
RH 3.4 Map	15	213.78	UniSTS
Cytogenetic Map	15	p13	UniSTS

Cma1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,417,760 - 29,418,259 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,601,347 - 34,601,845	NCBI	Rnor6.0
Rnor_5.0	15	38,491,281 - 38,491,779	UniSTS	Rnor5.0
Celera	15	28,991,554 - 28,992,052	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
14	12	51	86	87	86	55	77	55	6	298	161	11	65	60	81	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D38495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U67908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067539 ⟹ ENSRNOP00000061330

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,387,351 - 33,390,133 (-)	Ensembl
mRatBN7.2 Ensembl	15	29,417,451 - 29,420,233 (-)	Ensembl
Rnor_6.0 Ensembl	15	34,601,037 - 34,603,819 (-)	Ensembl

RefSeq Acc Id:

NM_013092 ⟹ NP_037224

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,387,351 - 33,390,133 (-)	NCBI
mRatBN7.2	15	29,417,451 - 29,420,233 (-)	NCBI
Rnor_6.0	15	34,601,037 - 34,603,819 (-)	NCBI
Rnor_5.0	15	38,490,971 - 38,493,753 (-)	NCBI
RGSC_v3.4	15	34,083,202 - 34,084,387 (-)	RGD
Celera	15	28,991,244 - 28,994,014 (-)	RGD

Sequence:

show sequence

AGCCTGCACAGCCCTGAGTAGCCCCTCAGAGAGGATGAATCTCCATGCTCTGTGTCTGCTGCTC
CTTCTCCTGGGTTCCAGCACCAAAGCTGGGGAGATCATCGGGGGCACGGAGTGCATACCACACT
CCCGCCCCTACATGGCCTATCTAGAAATTGTCACTTCTGACAATTACCTGTCAGCCTGCAGTGG
CTTCCTGATCAGACGAAACTTTGTGCTGACTGCAGCTCACTGTGCAGGACGGTCTATAACCGTC
CTCCTAGGAGCTCATAACAAAACATATAAAGAAGACACATGGCAGAAGCTCGAGGTTGAAAAGC
AATTCATTCATCCAAACTATGATAAGCGTTTGGTTCTCCATGACATCATGTTACTGAAGTTGAA
GGAGAAAGCCAAGCTAACCCTAGGCGTGGGAACCCTCCCACTCTCGGCCAACTTCAACTTCATT
CCACCCGGGAGAATGTGCAGGGCAGTTGGCTGGGGCAGAACAAACGTGAATGAACCAGCCTCTG
ACACACTGCAGGAAGTAAAGATGAGACTCCAGGAGCCCCAATCCTGCAAACACTTCACCAGTTT
TCAACACAAGTCCCAGTTGTGTGTGGGCAACCCCAAGAAGATGCAAAATGTATACAAGGGAGAC
TCTGGAGGACCTCTCCTGTGTGCTGGGATAGCCCAAGGCATTGCATCCTACGTACATCCGAATG
CAAAGCCCCCTGCTGTCTTCACCAGAATCTCCCATTACAGACCCTGGATCAATAAGATCTTGAG
GGAGAATTAACTCTGGATCTCGGGCCAGTGTGTGAGGAAATCTGGAGCTGGAATCGTGCAGGTT
TTCTGTGACATGGGATCTGGCCTGTCTGTAGTTCCTGCTGAAGCCCTTCCTGATCCCTGAGCTT
CCAGAAGGTTCTTACAAGTCACAGAAAGTTCCTAAAAGTCACCATCTTCATAAACCTCAATAAA
GAGCCAGATCCTAGACTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_037224	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB48261	(Get FASTA)	NCBI Sequence Viewer
	BAA07507	(Get FASTA)	NCBI Sequence Viewer
	EDM14296	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061330
	ENSRNOP00000061330.2
GenBank Protein	P50339	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037224 ⟸ NM_013092
- Peptide Label:	precursor
- UniProtKB:	Q9R2C8 (UniProtKB/Swiss-Prot), P50339 (UniProtKB/Swiss-Prot), A6KH67 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNLHALCLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTA AHCAGRSITVLLGAHNKTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIMLLKLKEKAKLTLGVGT LPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQSCKHFTSFQHKSQLCVGNP KKMQNVYKGDSGGPLLCAGIAQGIASYVHPNAKPPAVFTRISHYRPWINKILREN hide sequence

Ensembl Acc Id:

ENSRNOP00000061330 ⟸ ENSRNOT00000067539

Protein Domains

Peptidase S1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50339-F1-model_v2	AlphaFold	P50339	1-247	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699698

Promoter ID:

EPDNEW_R10221

Type:

initiation region

Name:

Cma1_1

Description:

chymase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,603,814 - 34,603,874	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2365	AgrOrtholog
BioCyc Gene	G2FUF-13674	BioCyc
Ensembl Genes	ENSRNOG00000020563	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000067539	ENTREZGENE
	ENSRNOT00000067539.3	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot
InterPro	Peptidase_S1_PA	UniProtKB/Swiss-Prot
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot
	Peptidase_S1A	UniProtKB/Swiss-Prot
	Trypsin_dom	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
KEGG Report	rno:25627	UniProtKB/Swiss-Prot
NCBI Gene	25627	ENTREZGENE
PANTHER	CHYMASE	UniProtKB/Swiss-Prot
	KALLIKREIN-RELATED	UniProtKB/Swiss-Prot
Pfam	Trypsin	UniProtKB/Swiss-Prot
PharmGKB	CMA1	RGD
PhenoGen	Cma1	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020563	RatGTEx
SMART	Tryp_SPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot
TIGR	TC207298
UniProt	A6KH67	ENTREZGENE, UniProtKB/TrEMBL
	CMA1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9R2C8	ENTREZGENE
UniProt Secondary	Q9R2C8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Cma1	chymase 1	Cma1	chymase 1, mast cell	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Cma1	chymase 1, mast cell		chymase 1	Name updated	1299863	APPROVED
2002-06-10	Cma1	chymase 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in peritoneal mast cells, skin, tongue and RBL2H3 basophilic leukemia cells; weakly expressed in jejunum of N. brasiliensis-infected rats	1298761
gene_expression	expressed in connective tissue mast cells of ear and peritoneum	69811
gene_function	has proteolytic activity	1298762
gene_process	may facilitate apoptosis by playing a role in fibronectin degradation and disruption of the p-FAK cell survival cascade	1298762
gene_protein	mature enzyme is 226 amino acids	1298761

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)