Symbol:
Chrna3
Name:
cholinergic receptor nicotinic alpha 3 subunit
RGD ID:
2345
Description:
Enables acetylcholine binding activity; heterocyclic compound binding activity; and postsynaptic neurotransmitter receptor activity. Involved in several processes, including acetylcholine receptor signaling pathway; presynaptic modulation of chemical synaptic transmission; and response to carbon monoxide. Located in dendrite; neuronal cell body; and plasma membrane raft. Part of acetylcholine-gated channel complex. Is active in cholinergic synapse; dopaminergic synapse; and postsynaptic specialization membrane. Biomarker of depressive disorder. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; chronic obstructive pulmonary disease; cocaine dependence; lung cancer (multiple); and nicotine dependence. Orthologous to human CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; nicotine pharmacodynamics pathway; nicotine pharmacokinetics pathway; INTERACTS WITH (S)-anabasine; (S)-nicotine; 1,1-dimethyl-4-phenylpiperazinium iodide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Acetylcholine receptor alpha 3 (neuronal nicotine); acetylcholine receptor alpha3; cetylcholine receptor alpha 3 (neuronal nicotine); cholinergic receptor nicotinic alpha polypeptide 4; cholinergic receptor, nicotinic, alpha 3; cholinergic receptor, nicotinic, alpha 3 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 3; neuronal acetylcholine receptor subunit alpha-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Chrna3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Chrna3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Chrna3 (cholinergic receptor nicotinic alpha 3 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CALY (calcyon neuron specific vesicular protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
chrna3 (cholinergic receptor, nicotinic, alpha 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
acr-12
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
acr-2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
acr-6
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
acr-8
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
nAChRalpha1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
nAChRalpha2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
nAChRbeta1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
nAChRbeta2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
nAChRalpha3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
nAChRalpha4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-38
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-63
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
lev-8
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
acr-3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Allele / Splice:
Chrna3em1Mcwi
Chrna3em9Mcwi
Genetic Models:
LEW-Chrna3em9Mcwi
LEW-Chrna3em1Mcwi
Candidate Gene For:
Bp273
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 64,297,755 - 64,311,251 (-) NCBI GRCr8 mRatBN7.2 8 55,401,668 - 55,415,165 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 55,401,702 - 55,415,165 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 60,943,296 - 60,956,354 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 59,222,294 - 59,235,355 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 57,086,538 - 57,099,598 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 59,594,007 - 59,607,122 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 59,592,403 - 59,607,275 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 58,176,165 - 58,189,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 58,570,223 - 58,583,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 58,588,997 - 58,602,801 (-) NCBI Celera 8 54,888,972 - 54,929,562 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chrna3 Rat (S)-anabasine multiple interactions EXP 6480464 Anabasine analog binds to and results in increased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:15615518 Chrna3 Rat (S)-nicotine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 CHRNA3 protein affects the reaction [Nicotine results in increased expression of CHRNA5 mRNA] more ... CTD PMID:18450646 more ... Chrna3 Rat (S)-nicotine affects response to substance ISO Chrna3 (Mus musculus) 6480464 CHRNA3 protein affects the susceptibility to Nicotine CTD PMID:15275829 Chrna3 Rat (S)-nicotine increases expression ISO Chrna3 (Mus musculus) 6480464 Nicotine results in increased expression of CHRNA3 mRNA CTD PMID:17135361 and PMID:29293602 Chrna3 Rat (S)-nicotine increases activity EXP 6480464 Nicotine results in increased activity of CHRNA3 protein CTD PMID:19483072 Chrna3 Rat (S)-nicotine decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Nicotine results in decreased expression of CHRNA3 mRNA CTD PMID:12628473 Chrna3 Rat (S)-nicotine multiple interactions EXP 6480464 Cocaine inhibits the reaction [Nicotine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] more ... CTD PMID:10336510 more ... Chrna3 Rat 1,1-dimethyl-4-phenylpiperazinium iodide multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Dimethylphenylpiperazinium Iodide results in increased activity of [CHRNB4 protein binds to CHRNA3 protein] CTD PMID:9454827 Chrna3 Rat 1,1-dimethyl-4-phenylpiperazinium iodide multiple interactions EXP 2303194 1 and 1-dimethyl-4-phenylpiperazinium iodide affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat 1,2-dichloroethane decreases expression ISO Chrna3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CHRNA3 mRNA CTD PMID:28960355 Chrna3 Rat 17alpha-ethynylestradiol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Ethinyl Estradiol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] and Ethinyl Estradiol inhibits the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] CTD PMID:11711029 Chrna3 Rat 17beta-estradiol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Estradiol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] and Estradiol promotes the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] CTD PMID:11711029 Chrna3 Rat 17beta-estradiol 3-benzoate increases expression EXP 6480464 estradiol 3-benzoate results in increased expression of CHRNA3 mRNA CTD PMID:32741896 Chrna3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Chrna3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Chrna3 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [2 more ... CTD PMID:32653021 Chrna3 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Chrna3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Chrna3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Chrna3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CHRNA3 mRNA CTD PMID:19465110 Chrna3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO CHRNA3 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Chrna3 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO CHRNA3 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of CHRNA3 mRNA CTD PMID:31326446 Chrna3 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of CHRNA3 mRNA CTD PMID:19162173 Chrna3 Rat 4-nonylphenol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 4-nonylphenol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] and 4-nonylphenol promotes the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] CTD PMID:11711029 Chrna3 Rat 4-octylphenol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 4-octylphenol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:11711029 Chrna3 Rat acetylcholine multiple interactions EXP 6480464 [Mercuric Chloride co-treated with Acetylcholine] affects the activity of [CHRNA3 protein binds to CHRNB4 protein] more ... CTD PMID:12130716 more ... Chrna3 Rat acetylcholine multiple interactions EXP 2303194 Acetylcholine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat acetylcholine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 4-nonylphenol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] more ... CTD PMID:11711029 more ... Chrna3 Rat acrylamide increases expression ISO CHRNA3 (Homo sapiens) 6480464 Acrylamide results in increased expression of CHRNA3 mRNA CTD PMID:32763439 Chrna3 Rat aflatoxin B1 increases expression ISO CHRNA3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CHRNA3 mRNA CTD PMID:22100608 and PMID:32234424 Chrna3 Rat all-trans-retinoic acid increases expression ISO Chrna3 (Mus musculus) 6480464 Tretinoin results in increased expression of CHRNA3 mRNA and Tretinoin results in increased expression of CHRNA3 protein CTD PMID:17203487 Chrna3 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CHRNA3 mRNA CTD PMID:20488242 Chrna3 Rat all-trans-retinoic acid increases expression ISO CHRNA3 (Homo sapiens) 6480464 Tretinoin results in increased expression of CHRNA3 mRNA CTD PMID:21934132 Chrna3 Rat all-trans-retinoic acid multiple interactions ISO Chrna3 (Mus musculus) 6480464 Tretinoin promotes the reaction [epibatidine binds to CHRNA3 protein] CTD PMID:17203487 Chrna3 Rat amitriptyline decreases expression EXP 6480464 Amitriptyline results in decreased expression of CHRNA3 mRNA CTD PMID:22341215 Chrna3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CHRNA3 mRNA CTD PMID:16483693 Chrna3 Rat antirheumatic drug decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CHRNA3 mRNA CTD PMID:24449571 Chrna3 Rat aristolochic acid A increases expression ISO CHRNA3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CHRNA3 mRNA CTD PMID:33212167 Chrna3 Rat atracurium multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Atracurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and Atracurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat belinostat increases expression ISO CHRNA3 (Homo sapiens) 6480464 belinostat results in increased expression of CHRNA3 mRNA CTD PMID:26272509 Chrna3 Rat belinostat multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHRNA3 mRNA CTD PMID:27188386 Chrna3 Rat benzo[a]pyrene affects methylation ISO CHRNA3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CHRNA3 5' UTR and Benzo(a)pyrene affects the methylation of CHRNA3 promoter CTD PMID:27901495 Chrna3 Rat benzo[a]pyrene increases expression ISO CHRNA3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CHRNA3 mRNA CTD PMID:32234424 Chrna3 Rat bisphenol A multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 bisphenol A inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] and bisphenol A promotes the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] CTD PMID:11711029 Chrna3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CHRNA3 mRNA CTD PMID:25181051 more ... Chrna3 Rat butanal increases expression ISO CHRNA3 (Homo sapiens) 6480464 butyraldehyde results in increased expression of CHRNA3 mRNA CTD PMID:26079696 Chrna3 Rat Butylbenzyl phthalate decreases expression ISO Chrna3 (Mus musculus) 6480464 butylbenzyl phthalate results in decreased expression of CHRNA3 mRNA CTD PMID:36746855 Chrna3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CHRNA3 mRNA CTD PMID:33453195 Chrna3 Rat carbachol affects binding EXP 6480464 Carbachol binds to [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:15615518 Chrna3 Rat carbachol multiple interactions EXP 2303194 Carbachol affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat carbamazepine affects expression ISO CHRNA3 (Homo sapiens) 6480464 Carbamazepine affects the expression of CHRNA3 mRNA CTD PMID:25979313 Chrna3 Rat carbaryl multiple interactions EXP 6480464 Carbaryl results in decreased activity of [CHRNA3 protein binds to CHRNB2 protein] and Carbaryl results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:14644616 Chrna3 Rat cisatracurium multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 cisatracurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and cisatracurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat cocaine multiple interactions EXP 6480464 Cocaine inhibits the reaction [Nicotine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] CTD PMID:10336510 Chrna3 Rat cytisine multiple interactions EXP 2303195 cytisine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat cytisine multiple interactions EXP 6480464 cytisine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:11600638 Chrna3 Rat cytisine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 cytisine results in increased activity of [CHRNB4 protein binds to CHRNA3 protein] CTD PMID:9454827 Chrna3 Rat DDE multiple interactions EXP 6480464 Dichlorodiphenyl Dichloroethylene inhibits the reaction [Dietary Fats results in increased expression of CHRNA3 mRNA] CTD PMID:28572628 Chrna3 Rat decabromodiphenyl ether increases expression ISO CHRNA3 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of CHRNA3 mRNA CTD PMID:31326446 Chrna3 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of CHRNA3 mRNA CTD PMID:17452286 and PMID:18812211 Chrna3 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of CHRNA3 mRNA CTD PMID:18812211 Chrna3 Rat diethylstilbestrol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Diethylstilbestrol inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]] and Diethylstilbestrol promotes the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] CTD PMID:11711029 Chrna3 Rat dihydro-beta-erythroidine multiple interactions EXP 2303195 dihydro-beta-erythroidine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat dihydro-beta-erythroidine multiple interactions EXP 2303194 dihydro-beta-erythroidine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat dihydro-beta-erythroidine multiple interactions EXP 6480464 Dihydro-beta-Erythroidine results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:9687574 Chrna3 Rat dopamine increases secretion EXP 6480464 CHRNA3 protein results in increased secretion of Dopamine CTD PMID:15542623 Chrna3 Rat dorsomorphin multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Chrna3 Rat doxorubicin decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CHRNA3 mRNA CTD PMID:29803840 Chrna3 Rat entinostat multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHRNA3 mRNA CTD PMID:27188386 Chrna3 Rat entinostat increases expression ISO CHRNA3 (Homo sapiens) 6480464 entinostat results in increased expression of CHRNA3 mRNA CTD PMID:26272509 Chrna3 Rat epibatidine affects binding EXP 2303194 Epibatidine binds to Chrna3 protein RGD Chrna3 Rat epibatidine multiple interactions EXP 6480464 epibatidine analog binds to and results in increased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:15615518 Chrna3 Rat epibatidine affects binding EXP 6480464 [CHRNA3 protein binds to CHRNB4 protein] which binds to epibatidine and epibatidine binds to [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:15615518 and PMID:9687574 Chrna3 Rat epibatidine multiple interactions ISO Chrna3 (Mus musculus) 6480464 Tretinoin promotes the reaction [epibatidine binds to CHRNA3 protein] CTD PMID:17203487 Chrna3 Rat epibatidine affects binding ISO Chrna3 (Mus musculus) 6480464 epibatidine binds to CHRNA3 protein CTD PMID:17203487 Chrna3 Rat epibatidine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 2-(1'-methyl-2'-pyrrolidinyl)-7-hydroxy-1 more ... CTD PMID:21942635 and PMID:22060139 Chrna3 Rat epibatidine affects binding ISO CHRNA3 (Homo sapiens) 6480464 [CHRNB4 protein binds to CHRNA3 protein] which binds to epibatidine CTD PMID:9454827 Chrna3 Rat epibatidine affects binding EXP 2303195 Epibatidine binds to Chrna3 protein RGD Chrna3 Rat EPTC multiple interactions EXP 6480464 EPTC results in decreased activity of [CHRNA3 protein binds to CHRNB2 protein] and EPTC results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:14644616 Chrna3 Rat ethanol decreases expression ISO Chrna3 (Mus musculus) 6480464 Ethanol results in decreased expression of CHRNA3 mRNA CTD PMID:29293602 Chrna3 Rat fenoxycarb multiple interactions EXP 6480464 fenoxycarb results in decreased activity of [CHRNA3 protein binds to CHRNB2 protein] and fenoxycarb results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:14644616 Chrna3 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CHRNA3 mRNA CTD PMID:30307764 Chrna3 Rat folic acid decreases expression ISO Chrna3 (Mus musculus) 6480464 Folic Acid results in decreased expression of CHRNA3 mRNA CTD PMID:25006883 Chrna3 Rat fonofos increases methylation ISO CHRNA3 (Homo sapiens) 6480464 Fonofos results in increased methylation of CHRNA3 promoter CTD PMID:22847954 Chrna3 Rat genistein decreases expression ISO Chrna3 (Mus musculus) 6480464 Genistein results in decreased expression of CHRNA3 mRNA CTD PMID:32186404 Chrna3 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of CHRNA3 mRNA CTD PMID:38314887 Chrna3 Rat Hexamethonium multiple interactions EXP 6480464 Hexamethonium results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:9687574 Chrna3 Rat imidacloprid multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 imidacloprid results in increased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:34628512 Chrna3 Rat Licochalcone B increases expression ISO CHRNA3 (Homo sapiens) 6480464 licochalcone B results in increased expression of CHRNA3 mRNA CTD PMID:33647349 Chrna3 Rat Mecamylamine multiple interactions ISO Chrna3 (Mus musculus) 6480464 Mecamylamine binds to and results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:20100906 Chrna3 Rat Mecamylamine multiple interactions EXP 6480464 Mecamylamine results in decreased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:11600638 and PMID:9687574 Chrna3 Rat mercury dichloride multiple interactions EXP 6480464 [Mercuric Chloride co-treated with Acetylcholine] affects the activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:12130716 Chrna3 Rat methyllycaconitine multiple interactions EXP 2303194 methyllycaconitine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat methyllycaconitine affects response to substance ISO Chrna3 (Mus musculus) 6480464 CHRNA3 protein affects the susceptibility to methyllycaconitine CTD PMID:19098233 Chrna3 Rat Mivacurium multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 mivacurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and mivacurium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat N'-Nitrosonornicotine affects binding ISO CHRNA3 (Homo sapiens) 6480464 N'-nitrosonornicotine binds to CHRNA3 protein CTD PMID:16835749 and PMID:18385738 Chrna3 Rat N-methyl-4-phenylpyridinium affects expression ISO CHRNA3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of CHRNA3 mRNA CTD PMID:12710931 Chrna3 Rat N-Nitrosopyrrolidine increases expression ISO CHRNA3 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of CHRNA3 mRNA CTD PMID:32234424 Chrna3 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of CHRNA3 mRNA CTD PMID:18812211 Chrna3 Rat nicotine increases expression ISO Chrna3 (Mus musculus) 6480464 Nicotine results in increased expression of CHRNA3 mRNA CTD PMID:17135361 and PMID:29293602 Chrna3 Rat nicotine multiple interactions EXP 2303194 Nicotine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat nicotine affects response to substance ISO Chrna3 (Mus musculus) 6480464 CHRNA3 protein affects the susceptibility to Nicotine CTD PMID:15275829 Chrna3 Rat nicotine increases activity EXP 6480464 Nicotine results in increased activity of CHRNA3 protein CTD PMID:19483072 Chrna3 Rat nicotine multiple interactions EXP 2303195 nicotine affects binding [Epibatidine binds to Chrna3 protein] RGD Chrna3 Rat nicotine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 CHRNA3 protein affects the reaction [Nicotine results in increased expression of CHRNA5 mRNA] more ... CTD PMID:18450646 more ... Chrna3 Rat nicotine decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Nicotine results in decreased expression of CHRNA3 mRNA CTD PMID:12628473 Chrna3 Rat nicotine multiple interactions EXP 6480464 Cocaine inhibits the reaction [Nicotine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] more ... CTD PMID:10336510 more ... Chrna3 Rat pancuronium multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Pancuronium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and Pancuronium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat panobinostat multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHRNA3 mRNA CTD PMID:27188386 Chrna3 Rat parathion increases methylation ISO CHRNA3 (Homo sapiens) 6480464 Parathion results in increased methylation of CHRNA3 promoter CTD PMID:22847954 Chrna3 Rat PCB138 multiple interactions ISO Chrna3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Chrna3 Rat pentanal increases expression ISO CHRNA3 (Homo sapiens) 6480464 pentanal results in increased expression of CHRNA3 mRNA CTD PMID:26079696 Chrna3 Rat phenylmercury acetate decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CHRNA3 mRNA CTD PMID:26272509 Chrna3 Rat phenylmercury acetate multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CHRNA3 mRNA CTD PMID:27188386 Chrna3 Rat propanal increases expression ISO CHRNA3 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CHRNA3 mRNA CTD PMID:26079696 Chrna3 Rat resveratrol multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CHRNA3 mRNA CTD PMID:23557933 Chrna3 Rat rocuronium multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 rocuronium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and rocuronium inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat sarin decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Sarin results in decreased expression of CHRNA3 mRNA CTD PMID:19522546 Chrna3 Rat SB 431542 multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Chrna3 Rat sunitinib decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CHRNA3 mRNA CTD PMID:31533062 Chrna3 Rat tamoxifen multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 4-nonylphenol promotes the reaction [Tamoxifen inhibits the reaction [Acetylcholine affects the activity of [CHRNA3 protein binds to CHRNB4 protein]]] more ... CTD PMID:11711029 Chrna3 Rat terbufos increases methylation ISO CHRNA3 (Homo sapiens) 6480464 terbufos results in increased methylation of CHRNA3 promoter CTD PMID:22847954 Chrna3 Rat Tetrachlorobisphenol A increases expression ISO CHRNA3 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of CHRNA3 mRNA CTD PMID:31326446 Chrna3 Rat tetrachloroethene multiple interactions EXP 6480464 Tetrachloroethylene inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] CTD PMID:15885267 Chrna3 Rat tetrachloroethene multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Tetrachloroethylene inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] CTD PMID:15885267 Chrna3 Rat thapsigargin decreases expression ISO CHRNA3 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of CHRNA3 mRNA CTD PMID:22378314 Chrna3 Rat Theaflavin 3,3'-digallate affects expression ISO CHRNA3 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of CHRNA3 mRNA CTD PMID:34925699 Chrna3 Rat titanium dioxide decreases methylation ISO Chrna3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CHRNA3 gene CTD PMID:35295148 Chrna3 Rat toluene multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Toluene inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] CTD PMID:15885267 Chrna3 Rat toluene multiple interactions EXP 6480464 Toluene inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] CTD PMID:15885267 Chrna3 Rat trichostatin A increases expression ISO CHRNA3 (Homo sapiens) 6480464 trichostatin A results in increased expression of CHRNA3 mRNA CTD PMID:24935251 Chrna3 Rat triptonide increases expression ISO Chrna3 (Mus musculus) 6480464 triptonide results in increased expression of CHRNA3 mRNA CTD PMID:33045310 Chrna3 Rat tubocurarine multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Tubocurarine inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] more ... CTD PMID:16931985 and PMID:34628512 Chrna3 Rat tubocurarine multiple interactions EXP 6480464 Tubocurarine inhibits the reaction [Acetylcholine binds to and results in increased activity of [CHRNB2 protein binds to CHRNA3 protein]] more ... CTD PMID:7808438 and PMID:9687574 Chrna3 Rat valproic acid increases methylation ISO CHRNA3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CHRNA3 gene CTD PMID:29154799 Chrna3 Rat valproic acid multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHRNA3 mRNA CTD PMID:27188386 Chrna3 Rat valproic acid increases expression ISO CHRNA3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CHRNA3 mRNA CTD PMID:24935251 more ... Chrna3 Rat valproic acid affects expression ISO Chrna3 (Mus musculus) 6480464 Valproic Acid affects the expression of CHRNA3 mRNA CTD PMID:26072468 Chrna3 Rat valproic acid affects expression ISO CHRNA3 (Homo sapiens) 6480464 Valproic Acid affects the expression of CHRNA3 mRNA CTD PMID:25979313 and PMID:26072468 Chrna3 Rat varenicline multiple interactions EXP 6480464 Varenicline binds to and results in increased activity of [CHRNA3 protein binds to CHRNB2 protein] and Varenicline binds to and results in increased activity of [CHRNA3 protein binds to CHRNB4 protein] CTD PMID:16766716 Chrna3 Rat vecuronium bromide multiple interactions ISO CHRNA3 (Homo sapiens) 6480464 Vecuronium Bromide inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB2 protein]] and Vecuronium Bromide inhibits the reaction [Acetylcholine results in increased activity of [CHRNA3 protein binds to CHRNB4 protein]] CTD PMID:16931985 Chrna3 Rat vorinostat decreases expression ISO CHRNA3 (Homo sapiens) 6480464 vorinostat results in decreased expression of CHRNA3 mRNA CTD PMID:27188386
Imported Annotations - SMPDB
(S)-anabasine (EXP) (S)-nicotine (EXP,ISO) 1,1-dimethyl-4-phenylpiperazinium iodide (EXP,ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (EXP) 4-nonylphenol (ISO) 4-octylphenol (ISO) acetylcholine (EXP,ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) amitriptyline (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) atracurium (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) carbachol (EXP) carbamazepine (ISO) carbaryl (EXP) cisatracurium (ISO) cocaine (EXP) cytisine (EXP,ISO) DDE (EXP) decabromodiphenyl ether (ISO) diazinon (EXP) dieldrin (EXP) diethylstilbestrol (ISO) dihydro-beta-erythroidine (EXP) dopamine (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) epibatidine (EXP,ISO) EPTC (EXP) ethanol (ISO) fenoxycarb (EXP) fenvalerate (EXP) folic acid (ISO) fonofos (ISO) genistein (ISO) glyphosate (EXP) Hexamethonium (EXP) imidacloprid (ISO) Licochalcone B (ISO) Mecamylamine (EXP,ISO) mercury dichloride (EXP) methyllycaconitine (EXP,ISO) Mivacurium (ISO) N'-Nitrosonornicotine (ISO) N-methyl-4-phenylpyridinium (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (EXP) nicotine (EXP,ISO) pancuronium (ISO) panobinostat (ISO) parathion (ISO) PCB138 (ISO) pentanal (ISO) phenylmercury acetate (ISO) propanal (ISO) resveratrol (ISO) rocuronium (ISO) sarin (ISO) SB 431542 (ISO) sunitinib (ISO) tamoxifen (ISO) terbufos (ISO) Tetrachlorobisphenol A (ISO) tetrachloroethene (EXP,ISO) thapsigargin (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) toluene (EXP,ISO) trichostatin A (ISO) triptonide (ISO) tubocurarine (EXP,ISO) valproic acid (ISO) varenicline (EXP) vecuronium bromide (ISO) vorinostat (ISO)
Biological Process
acetylcholine receptor signaling pathway (IBA,IGI) activation of transmembrane receptor protein tyrosine kinase activity (ISO) behavioral response to nicotine (IEA,ISO) excitatory postsynaptic potential (IEA,ISO) heart development (IEP) locomotory behavior (ISO) membrane depolarization (IBA) monoatomic ion transmembrane transport (IBA,IEA) monoatomic ion transport (IEA) nervous system development (IEA,ISO) neuromuscular synaptic transmission (IBA) presynaptic modulation of chemical synaptic transmission (EXP,IDA) regulation of acetylcholine secretion, neurotransmission (ISO) regulation of dendrite morphogenesis (ISO) regulation of membrane potential (ISO) regulation of muscle contraction (ISO) regulation of postsynaptic membrane potential (IEA) regulation of smooth muscle contraction (ISO) response to acetylcholine (IGI) response to carbon monoxide (IEP) response to nicotine (IBA,IEP) response to xenobiotic stimulus (IDA) signal transduction (IEA,ISO) synaptic transmission involved in micturition (IEA,ISO) synaptic transmission, cholinergic (IBA,IEA,ISO)
Cellular Component
acetylcholine-gated channel complex (IBA,IDA,IEA,IGI,ISO,TAS) cation channel complex (IEA,ISO) cholinergic synapse (IDA,ISO) ciliary basal body (IEA,ISO) cytosol (IEA,ISO) dendrite (IDA) dopaminergic synapse (EXP,IDA) endoplasmic reticulum (IEA) Golgi apparatus (IEA) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA) neuron projection (IBA) neuronal cell body (IDA) neurotransmitter receptor complex (IEA,ISO) nuclear speck (IEA,ISO) nucleolus (IEA,ISO) plasma membrane (IBA,IEA,ISO) plasma membrane raft (IGI) postsynaptic membrane (IEA) postsynaptic specialization membrane (IDA,ISO) presynapse (IEA) protein-containing complex (IDA) synapse (IBA,IEA) synaptic membrane (IEA)
1.
In vitro and in vivo effects of an alpha3 neuronal nicotinic acetylcholine receptor antisense oligonucleotide.
Adams MR, etal., Brain Res Mol Brain Res. 2004 Oct 22;129(1-2):67-79.
2.
Mammalian nicotinic acetylcholine receptors: from structure to function.
Albuquerque EX, etal., Physiol Rev. 2009 Jan;89(1):73-120. doi: 10.1152/physrev.00015.2008.
3.
Nicotinic acetylcholine receptor region on chromosome 15q25 and lung cancer risk among African Americans: a case-control study.
Amos CI, etal., J Natl Cancer Inst. 2010 Aug 4;102(15):1199-205. doi: 10.1093/jnci/djq232. Epub 2010 Jun 16.
4.
Aberrant DNA methylation of cancer-associated genes in gastric cancer in the European Prospective Investigation into Cancer and Nutrition (EPIC-EURGAST).
Balassiano K, etal., Cancer Lett. 2011 Dec 1;311(1):85-95. doi: 10.1016/j.canlet.2011.06.038. Epub 2011 Jul 14.
5.
Isolation of a cDNA clone coding for a possible neural nicotinic acetylcholine receptor alpha-subunit.
Boulter J, etal., Nature 1986 Jan 30-Feb 5;319(6052):368-74.
6.
Functional expression of two neuronal nicotinic acetylcholine receptors from cDNA clones identifies a gene family.
Boulter J, etal., Proc Natl Acad Sci U S A 1987 Nov;84(21):7763-7.
7.
New associations of the genetic polymorphisms in nicotinic receptor genes with the risk of lung cancer.
Chikova A, etal., Life Sci. 2012 Nov 27;91(21-22):1103-8. doi: 10.1016/j.lfs.2011.12.023. Epub 2012 Jan 17.
8.
The a7 nicotinic acetylcholine receptor function in hippocampal neurons is regulated by the lipid composition of the plasma membrane.
Colón-Sáez JO and Yakel JL, J Physiol. 2011 Jul 1;589(Pt 13):3163-74. doi: 10.1113/jphysiol.2011.209494. Epub 2011 May 3.
9.
Nicotinic acetylcholine receptor subtypes in the rat sympathetic ganglion: pharmacological characterization, subcellular distribution and effect of pre- and postganglionic nerve crush.
Del Signore A, etal., J Neuropathol Exp Neurol. 2004 Feb;63(2):138-50.
10.
Molecular biology and electrophysiology of neuronal nicotinic receptors of rat chromaffin cells.
Di Angelantonio S, etal., Eur J Neurosci 2003 Jun;17(11):2313-22.
11.
Developmental changes in the expression of nicotinic acetylcholine receptor alpha-subunits in the rat heart.
Dvorakova M, etal., Cell Tissue Res. 2005 Feb;319(2):201-9. Epub 2004 Nov 10.
12.
Transcription deregulation at the 15q25 locus in association with lung adenocarcinoma risk.
Falvella FS, etal., Clin Cancer Res. 2009 Mar 1;15(5):1837-42. doi: 10.1158/1078-0432.CCR-08-2107. Epub 2009 Feb 17.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Why do young women smoke? VII COMT as a risk modifying gene for Nicotine dependence - role of gene-gene interaction, personality, and environmental factors.
Greenbaum L, etal., Hum Psychopharmacol. 2010 Nov;25(7-8):536-42. doi: 10.1002/hup.1149. Epub 2010 Oct 25.
16.
Rare missense variants in CHRNB4 are associated with reduced risk of nicotine dependence.
Haller G, etal., Hum Mol Genet. 2012 Feb 1;21(3):647-55. doi: 10.1093/hmg/ddr498. Epub 2011 Oct 31.
17.
Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
Haller G, etal., Hum Mol Genet. 2014 Feb 1;23(3):810-9. doi: 10.1093/hmg/ddt463. Epub 2013 Sep 20.
18.
Down-regulation of cholinergic signaling in the habenula induces anhedonia-like behavior.
Han S, etal., Sci Rep. 2017 Apr 18;7(1):900. doi: 10.1038/s41598-017-01088-6.
19.
CHRNA3 polymorphism modifies lung adenocarcinoma risk in the Chinese Han population.
He P, etal., Int J Mol Sci. 2014 Mar 28;15(4):5446-57. doi: 10.3390/ijms15045446.
20.
The nicotinic receptor in the rat pineal gland is an alpha3beta4 subtype.
Hernandez SC, etal., Mol Pharmacol. 2004 Oct;66(4):978-87. doi: 10.1124/mol.104.002345. Epub 2004 Jul 9.
21.
ASCL1 regulates the expression of the CHRNA5/A3/B4 lung cancer susceptibility locus.
Improgo MR, etal., Mol Cancer Res. 2010 Feb;8(2):194-203. doi: 10.1158/1541-7786.MCR-09-0185. Epub 2010 Feb 2.
22.
A functional polymorphism on chromosome 15q25 associated with survival of early stage non-small-cell lung cancer.
Jin G, etal., J Thorac Oncol. 2012 May;7(5):808-14. doi: 10.1097/JTO.0b013e31824c7d7c.
23.
CHRNA3 genotype, nicotine dependence, lung function and disease in the general population.
Kaur-Knudsen D, etal., Eur Respir J. 2012 Dec;40(6):1538-44. doi: 10.1183/09031936.00176811. Epub 2012 Mar 22.
24.
CHRNA3 variant for lung cancer is associated with chronic obstructive pulmonary disease in Korea.
Kim WJ, etal., Respiration. 2013;86(2):117-22. doi: 10.1159/000342976. Epub 2012 Nov 27.
25.
CHRNA5/CHRNA3 Locus Associates with Increased Mortality among Smokers.
Kupiainen H, etal., COPD. 2016 Aug;13(4):464-70. doi: 10.3109/15412555.2015.1049260. Epub 2016 Jan 11.
26.
Quantitative analysis of the heteromeric neuronal nicotinic receptors in the rat hippocampus.
Lomazzo E, etal., J Neurochem. 2010 Nov;115(3):625-34. doi: 10.1111/j.1471-4159.2010.06967.x. Epub 2010 Sep 27.
27.
The ultrastructural distribution of putative nicotinic receptors on cultured neurons from the rat superior cervical ganglion.
Loring RH, etal., Neuroscience. 1988 Mar;24(3):1071-80.
28.
Nicotinic cholinergic receptors in the rat retina: simple and mixed heteromeric subtypes.
Marritt AM, etal., Mol Pharmacol. 2005 Dec;68(6):1656-68. Epub 2005 Aug 29.
29.
Expression of acetylcholine receptors by experimental rat renal allografts.
Meixner M, etal., Biomed Res Int. 2014;2014:289656. doi: 10.1155/2014/289656. Epub 2014 Jul 9.
30.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
31.
Methyllycaconitine is a potent antagonist of alpha-conotoxin-MII-sensitive presynaptic nicotinic acetylcholine receptors in rat striatum.
Mogg AJ, etal., J Pharmacol Exp Ther. 2002 Jul;302(1):197-204.
32.
Mouse Genome Database (MGD)
Mouse Genome Database (MGD)
33.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
34.
The nicotinic cholinergic system is affected in rats with delayed carbon monoxide encephalopathy.
Ochi S, etal., Neurosci Lett. 2014 May 21;569:33-7. doi: 10.1016/j.neulet.2014.03.054. Epub 2014 Apr 2.
35.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
36.
Measuring nicotinic receptors with characteristics of alpha4beta2, alpha3beta2 and alpha3beta4 subtypes in rat tissues by autoradiography.
Perry DC, etal., J Neurochem 2002 Aug;82(3):468-81.
37.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
38.
CHRNA3 rs1051730 and CHRNA5 rs16969968 polymorphisms are associated with heavy smoking, lung cancer, and chronic obstructive pulmonary disease in a mexican population.
Pérez-Morales R, etal., Ann Hum Genet. 2018 Nov;82(6):415-424. doi: 10.1111/ahg.12264. Epub 2018 Jul 11.
39.
Association between CHRNA3 rs1051730 genotype and lung cancer risk in Chinese Han population: a case-control study.
Ren JH, etal., J Huazhong Univ Sci Technolog Med Sci. 2013 Dec;33(6):897-901. doi: 10.1007/s11596-013-1218-4. Epub 2013 Dec 13.
40.
GOA pipeline
RGD automated data pipeline
41.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
42.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
43.
A Novel Tobacco Use Phenotype Suggests the 15q25 and 19q13 Loci May be Differentially Associated With Cigarettes per Day and Tobacco-Related Problems.
Richmond-Rakerd LS, etal., Nicotine Tob Res. 2017 Apr 1;19(4):426-434. doi: 10.1093/ntr/ntw260.
44.
The CHRNA5-CHRNA3-CHRNB4 nicotinic receptor subunit gene cluster affects risk for nicotine dependence in African-Americans and in European-Americans.
Saccone NL, etal., Cancer Res. 2009 Sep 1;69(17):6848-56. doi: 10.1158/0008-5472.CAN-09-0786. Epub 2009 Aug 25.
45.
Decreased nicotinic receptors in PC12 cells and rat brains influenced by fluoride toxicity--a mechanism relating to a damage at the level in post-transcription of the receptor genes.
Shan KR, etal., Toxicology. 2004 Aug 5;200(2-3):169-77.
46.
Correlation between polymorphisms of nicotine acetylcholine acceptor subunit CHRNA3 and lung cancer susceptibility.
Shen B, etal., Mol Med Rep. 2012 Dec;6(6):1389-92. doi: 10.3892/mmr.2012.1101. Epub 2012 Sep 26.
47.
Nicotine alters nicotinic receptor subunit levels differently in developing Mammalian sympathetic neurons.
Srivatsan M, etal., Ann N Y Acad Sci. 2006 Aug;1074:505-13.
48.
Study on polymorphisms in CHRNA5/CHRNA3/CHRNB4 gene cluster and the associated with the risk of non-small cell lung cancer.
Sun Y, etal., Oncotarget. 2017 Dec 20;9(2):2435-2444. doi: 10.18632/oncotarget.23459. eCollection 2018 Jan 5.
49.
Role of nicotine dependence on the relationship between variants in the nicotinic receptor genes and risk of lung adenocarcinoma.
Tseng TS, etal., PLoS One. 2014 Sep 18;9(9):e107268. doi: 10.1371/journal.pone.0107268. eCollection 2014.
50.
Time-dependent changes in rat brain cholinergic receptor expression after experimental brain injury.
Verbois SL, etal., J Neurotrauma. 2002 Dec;19(12):1569-85.
51.
Differential inhibition of rat alpha3* and alpha7 nicotinic acetylcholine receptors by tetrandrine and closely related bis-benzylisoquinoline derivatives.
Virginio C, etal., Neurosci Lett. 2005 Jun 24;381(3):299-304.
52.
Nicotinic acetylcholine receptor subtypes in rat superior cervical ganglion neurons as studied by sequential application of two alpha-subunit-specific antibodies.
Voitenko LP, etal., Neurosci Lett. 2001 Apr 27;303(1):37-40.
53.
Relationship between CYP2A6 and CHRNA5-CHRNA3-CHRNB4 variation and smoking behaviors and lung cancer risk.
Wassenaar CA, etal., J Natl Cancer Inst. 2011 Sep 7;103(17):1342-6. doi: 10.1093/jnci/djr237. Epub 2011 Jul 11.
54.
Genetic variants on chromosome 15q25 associated with lung cancer risk in Chinese populations.
Wu C, etal., Cancer Res. 2009 Jun 15;69(12):5065-72. doi: 10.1158/0008-5472.CAN-09-0081. Epub 2009 Jun 2.
55.
The comparative pharmacology and up-regulation of rat neuronal nicotinic receptor subtype binding sites stably expressed in transfected mammalian cells.
Xiao Y and Kellar KJ, J Pharmacol Exp Ther. 2004 Jul;310(1):98-107. Epub 2004 Mar 11.
56.
Functional polymorphisms of CHRNA3 predict risks of chronic obstructive pulmonary disease and lung cancer in Chinese.
Yang L, etal., PLoS One. 2012;7(10):e46071. doi: 10.1371/journal.pone.0046071. Epub 2012 Oct 3.
Chrna3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 64,297,755 - 64,311,251 (-) NCBI GRCr8 mRatBN7.2 8 55,401,668 - 55,415,165 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 55,401,702 - 55,415,165 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 60,943,296 - 60,956,354 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 59,222,294 - 59,235,355 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 57,086,538 - 57,099,598 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 59,594,007 - 59,607,122 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 59,592,403 - 59,607,275 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 58,176,165 - 58,189,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 58,570,223 - 58,583,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 58,588,997 - 58,602,801 (-) NCBI Celera 8 54,888,972 - 54,929,562 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
CHRNA3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 78,593,052 - 78,620,996 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 78,593,052 - 78,621,295 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 78,885,394 - 78,913,338 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 76,674,706 - 76,700,377 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 76,674,706 - 76,700,377 NCBI Celera 15 55,821,707 - 55,849,902 (-) NCBI Celera Cytogenetic Map 15 q25.1 NCBI HuRef 15 55,642,483 - 55,671,504 (-) NCBI HuRef CHM1_1 15 79,003,962 - 79,032,196 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 76,455,721 - 76,484,482 (-) NCBI T2T-CHM13v2.0
Chrna3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 54,917,401 - 54,933,846 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 54,917,395 - 54,933,846 (-) Ensembl GRCm39 Ensembl GRCm38 9 55,010,117 - 55,026,562 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 55,010,111 - 55,026,562 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 54,859,150 - 54,874,366 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 54,809,480 - 54,824,696 (-) NCBI MGSCv36 mm8 Celera 9 52,254,751 - 52,269,961 (-) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 29.84 NCBI
Chrna3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 977,075 - 1,011,372 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 979,630 - 1,011,316 (-) NCBI ChiLan1.0 ChiLan1.0
CHRNA3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 67,807,750 - 67,835,101 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 71,973,644 - 72,000,975 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 57,523,553 - 57,550,228 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 76,486,416 - 76,513,899 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 76,487,710 - 76,512,044 (-) Ensembl panpan1.1 panPan2
CHRNA3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 38,330,287 - 38,343,142 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 38,328,814 - 38,346,246 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 38,289,178 - 38,306,359 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 38,802,608 - 38,819,775 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 38,802,250 - 38,833,013 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 38,493,778 - 38,510,924 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 38,603,187 - 38,616,744 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 39,078,181 - 39,095,376 (+) NCBI UU_Cfam_GSD_1.0
Chrna3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 118,579,566 - 118,599,906 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 36,427,495 - 36,457,758 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 36,427,598 - 36,447,903 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CHRNA3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 47,361,899 - 47,384,303 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 47,361,710 - 47,382,743 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 52,787,929 - 52,806,220 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CHRNA3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 4,721,145 - 4,747,694 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 4,722,489 - 4,737,164 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 137,048,285 - 137,075,017 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Chrna3
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 31 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000019307 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1300150 Cm3 Cardiac mass QTL 3 3.97 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 54237814 55523877 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
D8Bord1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,415,430 - 55,415,660 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,607,541 - 59,607,770 NCBI Rnor6.0 Rnor_5.0 8 58,189,427 - 58,189,656 UniSTS Rnor5.0 RGSC_v3.4 8 58,584,012 - 58,584,242 RGD RGSC3.4 RGSC_v3.4 8 58,584,013 - 58,584,242 UniSTS RGSC3.4 Cytogenetic Map 8 q24 UniSTS
D8Wox30
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,415,432 - 55,415,597 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,607,543 - 59,607,707 NCBI Rnor6.0 Rnor_5.0 8 58,189,429 - 58,189,593 UniSTS Rnor5.0 RGSC_v3.4 8 58,584,015 - 58,584,179 UniSTS RGSC3.4 Cytogenetic Map 8 q24 UniSTS
BE108721
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,401,691 - 55,401,902 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,593,718 - 59,593,928 NCBI Rnor6.0 Rnor_5.0 8 58,175,876 - 58,176,086 UniSTS Rnor5.0 RGSC_v3.4 8 58,569,934 - 58,570,144 UniSTS RGSC3.4 Celera 8 54,888,683 - 54,888,893 UniSTS RH 3.4 Map 8 616.5 UniSTS Cytogenetic Map 8 q24 UniSTS
Chrnb4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,423,273 - 55,424,861 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,615,383 - 59,616,969 NCBI Rnor6.0 Rnor_5.0 8 58,197,269 - 58,198,855 UniSTS Rnor5.0 RGSC_v3.4 8 58,591,855 - 58,593,441 UniSTS RGSC3.4 Celera 8 54,907,410 - 54,908,996 UniSTS RH 3.4 Map 8 614.4 UniSTS Cytogenetic Map 8 q24 UniSTS
PMC312758P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,437,250 - 55,437,355 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,629,357 - 59,629,461 NCBI Rnor6.0 Rnor_5.0 8 58,211,243 - 58,211,347 UniSTS Rnor5.0 RGSC_v3.4 8 58,605,829 - 58,605,933 UniSTS RGSC3.4 Celera 8 54,921,384 - 54,921,488 UniSTS Cytogenetic Map 8 q24 UniSTS
Chrnb4
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 64,313,845 - 64,314,073 (+) Marker Load Pipeline mRatBN7.2 8 55,417,759 - 55,417,987 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,609,870 - 59,610,097 NCBI Rnor6.0 Rnor_5.0 8 58,191,756 - 58,191,983 UniSTS Rnor5.0 RGSC_v3.4 8 58,586,342 - 58,586,569 UniSTS RGSC3.4 Celera 8 54,901,897 - 54,902,124 UniSTS RH 3.4 Map 8 614.4 UniSTS Cytogenetic Map 8 q24 UniSTS
This gene Chrna3 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
16
112
46
41
15
22
15
5
97
55
93
17
33
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019307 ⟹ ENSRNOP00000019307
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 55,401,702 - 55,415,165 (-) Ensembl Rnor_6.0 Ensembl 8 59,592,403 - 59,607,275 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099747 ⟹ ENSRNOP00000085828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 55,401,702 - 55,413,569 (-) Ensembl
RefSeq Acc Id:
NM_052805 ⟹ NP_434692
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 64,297,755 - 64,311,251 (-) NCBI mRatBN7.2 8 55,401,668 - 55,415,165 (-) NCBI Rnor_6.0 8 59,594,007 - 59,607,122 (-) NCBI Rnor_5.0 8 58,176,165 - 58,189,008 (-) NCBI RGSC_v3.4 8 58,570,223 - 58,583,594 (-) RGD Celera 8 54,888,972 - 54,929,562 (-) RGD
Sequence:
ATGGGTGTTGTGCTGCTCCCGCCGCCGCTGTCCATGCTGATGCTGGTGCTGATGCTGCTGCCAGCGGCCAGTGCCTCAGAAGCTGAGCACCGCCTGTTCCAGTACCTGTTCGAAGATTACAACGAGAT
hide sequence
RefSeq Acc Id:
NP_434692 ⟸ NM_052805
- Peptide Label:
precursor
- UniProtKB:
P04757 (UniProtKB/Swiss-Prot), Q6PW51 (UniProtKB/TrEMBL), F1M7K6 (UniProtKB/TrEMBL)
- Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVD
hide sequence
Ensembl Acc Id:
ENSRNOP00000019307 ⟸ ENSRNOT00000019307
Ensembl Acc Id:
ENSRNOP00000085828 ⟸ ENSRNOT00000099747
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Chrna3
cholinergic receptor nicotinic alpha 3 subunit
Chrna3
cholinergic receptor, nicotinic, alpha 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-12
Chrna3
cholinergic receptor, nicotinic, alpha 3
Chrna3
cholinergic receptor, nicotinic, alpha 3 (neuronal)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-16
Chrna3
cholinergic receptor, nicotinic, alpha 3 (neuronal)
Chrna3
cholinergic receptor, nicotinic, alpha 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Chrna3
cholinergic receptor, nicotinic, alpha 3
Chrna3
cholinergic receptor, nicotinic, alpha polypeptide 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-10-22
Chrna3
cholinergic receptor, nicotinic, alpha polypeptide 3
Chrna3
cholinergic receptor, nicotinic, alpha polypeptide 4
Name updated
68913 APPROVED
2001-07-23
Chrna3
cholinergic receptor, nicotinic, alpha polypeptide 4
Chrna3
Acetylcholine receptor alpha 3 (neuronal nicotine)
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
