Advanced Search (OLGA)

Gene: Cd8a (CD8 subunit alpha) Rattus norvegicus

Analyze

Symbol:

Cd8a

Name:

CD8 subunit alpha

RGD ID:

2316

Description:

Enables protein kinase binding activity. Involved in response to methamphetamine hydrochloride. Located in cell surface. Biomarker of amphetamine abuse and brain infarction. Human ortholog(s) of this gene implicated in immunodeficiency 116. Orthologous to human CD8A (CD8 subunit alpha); PARTICIPATES IN interleukin-12 signaling pathway; antigen processing and presentation pathway; primary immunodeficiency pathway; INTERACTS WITH (+)-schisandrin B; (R)-lipoic acid; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CD8 antigen 32 kDa chain; CD8 antigen alpha-chain; CD8 antigen, alpha chain; CD8 antigen, alpha-chain; CD8a molecule; OX-8 membrane antigen; T-cell surface glycoprotein CD8 alpha chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD8A (CD8 subunit alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cd8a (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd8a (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD8A (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD8A (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd8a (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD8A (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD8A (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd8a (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cd8a (CD8 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MLYCD (malonyl-CoA decarboxylase)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Cd8a (CD8 subunit alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CD8A (CD8 subunit alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CD8A (CD8 subunit alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	cd8a (CD8a molecule)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	cd8a (CD8a molecule)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100489117	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	104,924,116 - 104,928,353 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	104,900,833 - 104,928,358 (+)	Ensembl				GRCr8
mRatBN7.2	4	103,365,804 - 103,370,041 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	103,365,804 - 103,370,040 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	108,748,755 - 108,752,992 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	104,523,859 - 104,528,097 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	103,135,733 - 103,139,970 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	99,217,640 - 99,243,352 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	99,239,115 - 99,243,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	163,993,814 - 164,022,356 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	104,589,922 - 104,594,159 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	92,538,482 - 92,542,731 (+)	NCBI		Celera
RGSC_v3.1	4	104,834,402 - 104,838,639 (+)	NCBI
Cytogenetic Map	4	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acquired immunodeficiency syndrome (ISO)

amphetamine abuse (IEP)

anogenital venereal wart (ISO)

brain infarction (IEP)

chronic obstructive pulmonary disease (ISO)

Chronic Rhinosinusitis (ISO)

COVID-19 (ISO)

Epstein-Barr virus infectious disease (ISO)

erythema multiforme (ISO)

herpes simplex (ISO)

human immunodeficiency virus infectious disease (ISO)

immunodeficiency 116 (ISO)

influenza (ISO)

leprosy (ISO)

listeriosis (ISO)

proteinuria (ISO)

Spontaneous Abortions (ISO)

stomach cancer (ISO)

traumatic brain injury (ISO)

tuberculosis (ISO)

Viral Myocarditis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(D-Ala(2)-mephe(4)-gly-ol(5))enkephalin (ISO)

(R)-lipoic acid (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acetylsalicylic acid (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

ammonium acetate (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

auranofin (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butanal (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

cisplatin (ISO)

Cuprizon (EXP)

curcumin (ISO)

cycloheximide (ISO)

cyclophosphamide (ISO)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dichloroacetic acid (ISO)

dichloromethane (EXP)

diethylstilbestrol (ISO)

dioxygen (EXP)

endosulfan (EXP)

ethylbenzene (EXP)

fingolimod hydrochloride (ISO)

flavonoids (EXP)

fluoxetine (ISO)

fonofos (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glycidol (EXP)

lipoic acid (EXP)

methamphetamine (EXP)

methcathinone (ISO)

methimazole (EXP)

methotrexate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

oxaliplatin (EXP)

ozone (ISO)

parathion (ISO)

PCB138 (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

phenacetin (EXP)

phenylhydrazine (EXP)

pirinixic acid (ISO)

propanal (ISO)

raloxifene (EXP)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

terbufos (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

cell surface receptor signaling pathway (IBA,ISO)

cytotoxic T cell differentiation (IBA,ISO)

defense response to virus (ISO)

immune system process (IEA)

positive regulation of calcium-mediated signaling (ISO)

response to methamphetamine hydrochloride (IEP)

T cell activation (ISO)

T cell mediated immunity (IBA,ISO)

T cell receptor signaling pathway (ISO)

Cellular Component

cell surface (IDA,ISO)

external side of plasma membrane (IBA,ISO)

plasma membrane (IEA,ISO)

plasma membrane raft (ISO)

receptor complex (ISO)

Molecular Function

identical protein binding (ISO)

MHC class I protein complex binding (ISO)

protein binding (ISO)

protein kinase binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

antigen processing and presentation pathway (IEA)

interleukin-12 signaling pathway (ISO)

primary immunodeficiency pathway (IEA)

T cell receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat CD4+CD8+ macrophages kill tumor cells through an NKG2D- and granzyme/perforin-dependent mechanism.	Baba T, etal., J Immunol. 2008 Mar 1;180(5):2999-3006.
2.	Molecular associations between the T-lymphocyte antigen receptor complex and the surface antigens CD2, CD4, or CD8 and CD5.	Beyers AD, etal., Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2945-9.
3.	Identification of new therapeutic targets by genome-wide analysis of gene expression in the ipsilateral cortex of aged rats after stroke.	Buga AM, etal., PLoS One. 2012;7(12):e50985. doi: 10.1371/journal.pone.0050985. Epub 2012 Dec 12.
4.	Heat-induced reactivation of HSV-1 in latent mice: upregulation in the TG of CD83 and other immune response genes and their LAT-ICP0 locus.	Clement C, etal., Invest Ophthalmol Vis Sci. 2009 Jun;50(6):2855-61. doi: 10.1167/iovs.08-2430. Epub 2009 Jan 17.
5.	Effects of purified anti-Lyt-2 mAb treatment on murine listeriosis: comparative roles of Lyt-2+ and L3T4+ cells in resistance to primary and secondary infection, delayed-type hypersensitivity and adoptive transfer of resistance.	Czuprynski CJ and Brown JF, Immunology. 1990 Sep;71(1):107-12.
6.	Characterization of CD31 expression on murine and human neonatal T lymphocytes during development and activation.	Fike AJ, etal., Pediatr Res. 2017 Jul;82(1):133-140. doi: 10.1038/pr.2017.81. Epub 2017 Apr 26.
7.	Clinical features of cytotoxic CD8+ T-lymphocyte deficiency in chronic rhinosinusitis patients: a demographic and functional study.	Gabra N, etal., Int Forum Allergy Rhinol. 2014 Jun;4(6):495-501. doi: 10.1002/alr.21313. Epub 2014 Mar 17.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Immune suppression in advanced chronic fascioliasis: an experimental study in a rat model.	Gironès N, etal., J Infect Dis. 2007 May 15;195(10):1504-12. doi: 10.1086/514822. Epub 2007 Apr 11.
10.	Lung Expression of Human Angiotensin-Converting Enzyme 2 Sensitizes the Mouse to SARS-CoV-2 Infection.	Han K, etal., Am J Respir Cell Mol Biol. 2021 Jan;64(1):79-88. doi: 10.1165/rcmb.2020-0354OC.
11.	Regression of human T-cell leukemia virus type I (HTLV-I)-associated lymphomas in a rat model: peptide-induced T-cell immunity.	Hanabuchi S, etal., J Natl Cancer Inst. 2001 Dec 5;93(23):1775-83. doi: 10.1093/jnci/93.23.1775.
12.	Purification, chain separation and sequence of the MRC OX-8 antigen, a marker of rat cytotoxic T lymphocytes.	Johnson P, etal., EMBO J 1985 Oct;4(10):2539-45.
13.	Depletion of regulatory T cells increases T cell brain infiltration, reactive astrogliosis, and interferon-γ gene expression in acute experimental traumatic brain injury.	Krämer TJ, etal., J Neuroinflammation. 2019 Aug 5;16(1):163. doi: 10.1186/s12974-019-1550-0.
14.	Immunomodulation by interleukin-4 suppresses matrix metalloproteinases and improves cardiac function in murine myocarditis.	Li J, etal., Eur J Pharmacol. 2007 Jan 5;554(1):60-8. doi: 10.1016/j.ejphar.2006.08.024. Epub 2006 Aug 26.
15.	Clinical and pathological investigation of severe COVID-19 patients.	Li S, etal., JCI Insight. 2020 May 19. pii: 138070. doi: 10.1172/jci.insight.138070.
16.	In vivo antiviral host transcriptional response to SARS-CoV-2 by viral load, sex, and age.	Lieberman NAP, etal., PLoS Biol. 2020 Sep 8;18(9):e3000849. doi: 10.1371/journal.pbio.3000849. eCollection 2020 Sep.
17.	Methamphetamine decreases CD4 T cell frequency and alters pro-inflammatory cytokine production in a model of drug abuse.	Mata MM, etal., Eur J Pharmacol. 2015 Apr 5;752:26-33. doi: 10.1016/j.ejphar.2015.02.002. Epub 2015 Feb 10.
18.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
19.	Better-surviving liver grafts by the injection of anti-CD2 antibody: the important roles of host CD8+ and CD2+CD28+ T cells in chronic graft rejection and beta type platelet-derived growth factor receptor (PDGFR-beta) expression on apoptotic liver grafts.	Nakatsuji T Tohoku J Exp Med. 1999 Mar;187(3):215-25.
20.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.	Regulation of CD8 expression in mast cells by exogenous or endogenous nitric oxide.	Nohara O, etal., J Immunol 2001 Nov 15;167(10):5935-9.
22.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
23.	Experimental antibacterial therapy with puroindolines, lactoferrin and lysozyme in Listeria monocytogenes-infected mice.	Palumbo D, etal., Microbes Infect. 2010 Jul;12(7):538-45. doi: 10.1016/j.micinf.2010.03.010. Epub 2010 Mar 27.
24.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
25.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.	Supplementing suckling rats with whey protein concentrate modulates the immune response and ameliorates rat rotavirus-induced diarrhea.	Pérez-Cano FJ, etal., J Nutr. 2008 Dec;138(12):2392-8. doi: 10.3945/jn.108.093856.
27.	GOA pipeline	RGD automated data pipeline
28.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Upregulation of major histocompatibility complex (MHC) antigen in nephritis associated with murine malaria infection.	Rui-Mei L, etal., J Pathol. 1998 Jun;185(2):212-8. doi: 10.1002/(SICI)1096-9896(199806)185:2<212::AID-PATH61>3.0.CO;2-T.
31.	Robust CD8+ T-cell proliferation and diversification after mogamulizumab in patients with adult T-cell leukemia-lymphoma.	Saito M, etal., Blood Adv. 2020 May 26;4(10):2180-2191. doi: 10.1182/bloodadvances.2020001641.
32.	Transcriptional analysis of immune genes in Epstein-Barr virus-associated gastric cancer and association with clinical outcomes.	Sundar R, etal., Gastric Cancer. 2018 Nov;21(6):1064-1070. doi: 10.1007/s10120-018-0851-9. Epub 2018 Jun 18.
33.	Association between Tim‑3 and Gal‑9 expression and gastric cancer prognosis.	Wang Y, etal., Oncol Rep. 2018 Oct;40(4):2115-2126. doi: 10.3892/or.2018.6627. Epub 2018 Aug 6.
34.	Phenotype and function of GM-CSF independent dendritic cells generated by long-term propagation of rat bone marrow cells.	Yan H, etal., Cell Immunol. 2004 Jun;229(2):117-29. doi: 10.1016/j.cellimm.2004.07.006.

Additional References at PubMed

PMID:1673361	PMID:1908233	PMID:2493728	PMID:2784196	PMID:6610701	PMID:7589135	PMID:8688082	PMID:8755570	PMID:8788039	PMID:9177355	PMID:9208839	PMID:9830036
PMID:10072077	PMID:10648399	PMID:10704459	PMID:10943842	PMID:11131152	PMID:12477932	PMID:14568922	PMID:14609575	PMID:15240714	PMID:15294943	PMID:15322158	PMID:15489334
PMID:15728238	PMID:15749886	PMID:15795238	PMID:15843532	PMID:16287714	PMID:16455951	PMID:16973387	PMID:17082577	PMID:17213291	PMID:17277142	PMID:17341584	PMID:17357106
PMID:18776904	PMID:18836449	PMID:18984740	PMID:19349303	PMID:19565478	PMID:19723499	PMID:19838199	PMID:19934022	PMID:20709950	PMID:21460847	PMID:21508411	PMID:22068125
PMID:22072979	PMID:24257693	PMID:31681288

Genomics

Comparative Map Data

Cd8a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	104,924,116 - 104,928,353 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	104,900,833 - 104,928,358 (+)	Ensembl				GRCr8
mRatBN7.2	4	103,365,804 - 103,370,041 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	103,365,804 - 103,370,040 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	108,748,755 - 108,752,992 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	104,523,859 - 104,528,097 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	103,135,733 - 103,139,970 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	99,217,640 - 99,243,352 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	99,239,115 - 99,243,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	163,993,814 - 164,022,356 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	104,589,922 - 104,594,159 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	92,538,482 - 92,542,731 (+)	NCBI		Celera
RGSC_v3.1	4	104,834,402 - 104,838,639 (+)	NCBI
Cytogenetic Map	4	q32	NCBI

CD8A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	86,784,605 - 86,808,396 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	86,784,610 - 86,808,396 (-)	Ensembl			hg38	GRCh38
GRCh37	2	87,011,728 - 87,035,519 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	86,865,239 - 86,871,638 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	86,923,391 - 86,929,725	NCBI
Celera	2	86,839,534 - 86,863,331 (-)	NCBI		Celera
Cytogenetic Map	2	p11.2	NCBI
HuRef	2	86,898,000 - 86,921,798 (-)	NCBI		HuRef
CHM1_1	2	86,941,749 - 86,965,554 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	86,786,504 - 86,810,303 (-)	NCBI		T2T-CHM13v2.0

Cd8a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	71,350,411 - 71,356,155 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	71,350,411 - 71,356,157 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	71,373,427 - 71,379,171 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	71,373,427 - 71,379,173 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	71,323,421 - 71,329,165 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	71,302,936 - 71,308,680 (+)	NCBI		MGSCv36	mm8
Celera	6	73,452,794 - 73,458,537 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	32.14	NCBI

Cd8a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	952,502 - 978,636 (+)	Ensembl
ChiLan1.0	NW_004955424	952,595 - 979,159 (+)	NCBI	ChiLan1.0	ChiLan1.0

CD8A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	39,579,706 - 39,603,326 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	39,582,466 - 39,606,086 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	86,832,559 - 86,855,772 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	88,376,411 - 88,383,519 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	88,377,722 - 88,382,635 (-)	Ensembl			panPan2	panpan1.1

CD8A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	38,396,022 - 38,400,508 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	38,369,414 - 38,400,508 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	38,080,864 - 38,085,351 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	39,127,938 - 39,132,423 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	39,127,889 - 39,132,423 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	38,294,729 - 38,299,212 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	38,330,601 - 38,335,086 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	38,679,136 - 38,683,623 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cd8a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	79,968,389 - 79,973,360 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936712	885,458 - 890,852 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936712	885,301 - 891,247 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD8A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	57,998,891 - 58,029,760 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	57,999,228 - 58,029,768 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	60,852,723 - 60,859,977 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD8A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	18,878,013 - 18,885,183 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	18,878,622 - 18,883,885 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666080	896,572 - 903,593 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd8a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624749	16,564,944 - 16,569,890 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cd8a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	74,383,243 - 74,388,142 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cd8a
36 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	47
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000009515
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	96731383	141731383	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	103834277	148834277	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	148	91	90	59	92	59	6	354	191	11	123	80	92	31	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006236630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X03015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009515 ⟹ ENSRNOP00000009516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	104,900,839 - 104,928,358 (+)	Ensembl
mRatBN7.2 Ensembl	4	103,365,804 - 103,370,040 (+)	Ensembl
Rnor_6.0 Ensembl	4	99,239,115 - 99,243,351 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000161718 ⟹ ENSRNOP00000106503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	104,900,833 - 104,928,352 (+)	Ensembl

RefSeq Acc Id:

NM_031538 ⟹ NP_113726

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	104,924,116 - 104,928,353 (+)	NCBI
mRatBN7.2	4	103,365,804 - 103,370,041 (+)	NCBI
Rnor_6.0	4	99,239,115 - 99,243,352 (+)	NCBI
Rnor_5.0	4	163,993,814 - 164,022,356 (+)	NCBI
RGSC_v3.4	4	104,589,922 - 104,594,159 (+)	RGD
Celera	4	92,538,482 - 92,542,731 (+)	RGD

Sequence:

show sequence

CACACCATGGCCTCACGGGTGATCTGCTTTCTGTCGCTGAACCTGCTACTGCTGGATGTTATCA
CTAGGCTCCAGGTTTCCGGACAGTTACAGTTGTCACCAAAGAAAGTGGACGCTGAAATTGGCCA
GGAGGTGAAGCTAACATGCGAAGTGCTGCGGGACACTTCGCAAGGATGCTCTTGGCTCTTCCGG
AACTCCAGCTCCGAACTCCTCCAGCCCACCTTCATCATCTATGTATCTTCATCCCGGAGCAAGC
TGAACGATATACTGGATCCGAATCTGTTCTCTGCCCGGAAGGAAAACAACAAATACATCCTCAC
CCTGAGCAAGTTCAGCACTAAAAACCAAGGCTACTATTTCTGCTCAATCACCAGCAACTCGGTG
ATGTACTTCAGTCCTCTGGTGCCGGTGTTTCAGAAAGTGAACTCTATTATCACCAAGCCGGTGA
CGCGAGCTCCCACACCAGTGCCTCCTCCTACAGGGACACCCCGGCCCCTACGACCAGAAGCTTG
CCGACCCGGGGCGAGTGGCTCAGTGGAGGGAATGGGATTGGGCTTCGCCTGCGATATTTACATC
TGGGCACCCTTGGCCGGAATCTGCGCGGTTCTTCTGCTGTCCCTGGTCATCACTCTCATCTGCT
GCCACAGGAACCGAAGGCGTGTTTGCAAATGTCCCAGGCCCCTTGTCAAGCCCAGACCTTCAGA
GAAATTCGTGTAAAATGGCGCCACTAGGAAGCCACAACTACTACATGACTTCAGAGATTTCTCA
CAAGAGACCGGGCCCTCCTTTTTCAGAGTTTCCTGCTGGCTTATATATTGTCCTCTGTATTGTT
TTAGGGGTAGGATGGGGACAGTTCCTTTTTCTTTATGAATTCTCTTTGATACAAAACATACTTG
TATGCACACAATGGGGTAAAGATCAGACTGTAACACCAGAGATAGTCCCAGTTTCAGGGTCAGC
GTAGCTGGTGGCCTCGGCACCCACTTGATATAAATCTCCGGTCTGCCCATCATATAGAAGAAGC
TGAAGATCAGAGATGGGAACAGCAAGATCTGTAGACCAGGAGAGAACCCAAGCTGAAGGACCCC
TCACTAGCTGGTGCAGGGATCTCATCCCCCTCCCCTGAGCTCTCTGTTTAGGTGACACACTTGT
GCCTCAAACCACAGGGAGCAAGTGGTATGAACCTGTGATCTGCTCAGCTCTGCCTGTGAGCGTC
AGATGAAACAAATCCAAGACAAGAGAACTGCCCTTAGCAGTGCAACTGGACATCAGAGCTCCTT
GTAAGGAACTGGGAAATTGCTGGCAGTCAAGGGAAGGGGTAGAGTAAATCTGGAAAACAGTCCC
CTCTGTCACTGAAGACTAACTCAATTAAAGCTATTCAAACCACCAAAAAAAAAAAAAAAAAAAA
AAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113726	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88126	(Get FASTA)	NCBI Sequence Viewer
	CAA26798	(Get FASTA)	NCBI Sequence Viewer
	EDL90991	(Get FASTA)	NCBI Sequence Viewer
	EDL90992	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009516.3
	ENSRNOP00000106503
GenBank Protein	P07725	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113726 ⟸ NM_031538
- Peptide Label:	precursor
- UniProtKB:	P07725 (UniProtKB/Swiss-Prot), A6IA73 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASRVICFLSLNLLLLDVITRLQVSGQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNS SSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMY FSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWA PLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV hide sequence

Ensembl Acc Id:

ENSRNOP00000009516 ⟸ ENSRNOT00000009515

Ensembl Acc Id:

ENSRNOP00000106503 ⟸ ENSRNOT00000161718

Protein Domains

Ig-like Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P07725-F1-model_v2	AlphaFold	P07725	1-236	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693113

Promoter ID:

EPDNEW_R3638

Type:

initiation region

Name:

Cd8a_1

Description:

CD8a molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	99,239,116 - 99,239,176	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2316	AgrOrtholog
BioCyc Gene	G2FUF-44184	BioCyc
Ensembl Genes	ENSRNOG00000007178	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009515.5	UniProtKB/Swiss-Prot
	ENSRNOT00000161718	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7381324	IMAGE-MGC_LOAD
InterPro	CD8_asu	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_V-set	UniProtKB/Swiss-Prot
KEGG Report	rno:24930	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108655	IMAGE-MGC_LOAD
NCBI Gene	24930	ENTREZGENE
PANTHER	PTHR10441	UniProtKB/Swiss-Prot
	T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN	UniProtKB/Swiss-Prot
Pfam	V-set	UniProtKB/Swiss-Prot
PhenoGen	Cd8a	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007178	RatGTEx
SMART	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A6IA73	ENTREZGENE, UniProtKB/TrEMBL
	A6IA74_RAT	UniProtKB/TrEMBL
	CD8A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-01-27	Cd8a	CD8 subunit alpha	Cd8a	CD8a molecule	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Cd8a	CD8a molecule	Cd8a	CD8 antigen, alpha chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Cd8a	CD8 antigen, alpha-chain			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed on alveolar macrophages and peritoneal mast cells	728221

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)