Advanced Search (OLGA)

Gene: S100g (S100 calcium binding protein G) Rattus norvegicus

Analyze

Symbol:

S100g

Name:

S100 calcium binding protein G

RGD ID:

2253

Description:

Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Predicted to be located in apical plasma membrane and basolateral plasma membrane. Predicted to be active in cytoplasm. Orthologous to human S100G (S100 calcium binding protein G); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

9 kDa CaBP; CaBP; Calb3; calbindin 3; calbindin 3, (vitamin D-dependent calcium binding protein); calbindin-D9K; Calcium-binding protein intestinal vitamin D-dependent (9-kDa CaBP); calcium-binding protein, intestinal, vitamin D-dependent (9-kDa CaBP); Cbpi; cholecalcin; MGC72928; protein S100-G; RNCALBD9; S100 calcium-binding protein G; vitamin D-dependent calcium-binding protein, intestinal

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	35,337,636 - 35,340,205 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	35,337,675 - 35,340,205 (+)	Ensembl				GRCr8
mRatBN7.2	X	31,705,853 - 31,708,422 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	31,705,866 - 31,708,433 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	32,740,258 - 32,742,781 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	36,175,676 - 36,178,203 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	32,364,662 - 32,367,187 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	33,442,820 - 33,445,714 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	33,443,186 - 33,445,709 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	33,790,619 - 33,793,188 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	52,446,817 - 52,449,342 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	32,019,786 - 32,022,301 (+)	NCBI		Celera
RGSC_v3.1	X	52,500,285 - 52,502,811 (+)	NCBI
Cytogenetic Map	X	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gestational diabetes (ISO)

pre-eclampsia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-nonylphenol (EXP)

4-tert-Octylphenol (EXP)

acetamide (EXP)

aflatoxin B1 (EXP)

alfacalcidol (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (EXP)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

Butylparaben (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (EXP,ISO)

calcium atom (EXP)

calcium(0) (EXP)

capsaicin (EXP)

carbon nanotube (ISO)

carnosic acid (ISO)

CGP 52608 (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

copper atom (EXP)

copper(0) (EXP)

curcumin (EXP)

cyclosporin A (EXP)

dextran sulfate (ISO)

diethylstilbestrol (EXP,ISO)

dimethylarsinic acid (ISO)

dioxygen (EXP,ISO)

folic acid (ISO)

fulvestrant (EXP,ISO)

furosemide (ISO)

genistein (EXP)

gentamycin (ISO)

hexadecanoic acid (ISO)

hydrogen peroxide (EXP)

irinotecan (EXP)

Isobutylparaben (EXP)

Isopropylparaben (EXP)

L-ascorbic acid (ISO)

L-methionine (ISO)

lithocholic acid (EXP,ISO)

melatonin (EXP)

methoxychlor (EXP)

methylarsonic acid (ISO)

mifepristone (EXP,ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nitrofen (EXP)

Nonylphenol (EXP,ISO)

ochratoxin A (EXP)

p-tert-Amylphenol (EXP)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

pirinixic acid (EXP,ISO)

pravastatin (EXP,ISO)

progesterone (ISO)

propylparaben (EXP)

quercetin (ISO)

sirolimus (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

sulforaphane (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

tetramethrin (EXP)

titanium dioxide (ISO)

trichloroethene (EXP,ISO)

triclosan (EXP)

uranium atom (EXP)

vancomycin (ISO)

vinclozolin (EXP)

zaragozic acid A (EXP,ISO)

zearalenone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

apical plasma membrane (IEA,ISO)

basolateral plasma membrane (IEA,ISO)

cytoplasm (IBA)

Molecular Function

calcium ion binding (IBA,IEA)

calcium-dependent protein binding (IBA)

metal ion binding (IEA)

protein binding (ISO)

transition metal ion binding (IEA)

vitamin D binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Parabens inhibit the early phase of folliculogenesis and steroidogenesis in the ovaries of neonatal rats.	Ahn HJ, etal., Mol Reprod Dev. 2012 Sep;79(9):626-36. doi: 10.1002/mrd.22070. Epub 2012 Jul 26.
2.	Molecular cloning of the cDNA and chromosomal gene for vitamin D-dependent calcium-binding protein of rat intestine.	Darwish HM, etal., Proc Natl Acad Sci U S A 1987 Sep;84(17):6108-11.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Structure and nucleotide sequence of the rat intestinal vitamin D-dependent calcium binding protein gene.	Krisinger J, etal., Proc Natl Acad Sci U S A 1988 Dec;85(23):8988-92.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	The rat vitamin-D-dependent calcium-binding protein (9-kDa CaBP) gene. Complete nucleotide sequence and structural organization.	Perret C, etal., Eur J Biochem 1988 Feb 15;172(1):43-51.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Cytosolic Ca2+ buffers.	Schwaller B, Cold Spring Harb Perspect Biol. 2010 Nov;2(11):a004051. doi: 10.1101/cshperspect.a004051. Epub 2010 Oct 13.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	Disrupted placental vitamin D metabolism and calcium signaling in gestational diabetes and pre-eclampsia patients.	Varshney S, etal., Endocrine. 2023 Apr;80(1):191-200. doi: 10.1007/s12020-022-03272-9. Epub 2022 Dec 8.

Additional References at PubMed

PMID:3741407	PMID:6315698	PMID:12205031	PMID:12477932	PMID:14622990	PMID:15489334	PMID:15635152	PMID:16246455	PMID:17410547	PMID:18313836	PMID:21605449	PMID:25674214

Genomics

Comparative Map Data

S100g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	35,337,636 - 35,340,205 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	35,337,675 - 35,340,205 (+)	Ensembl				GRCr8
mRatBN7.2	X	31,705,853 - 31,708,422 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	31,705,866 - 31,708,433 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	32,740,258 - 32,742,781 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	36,175,676 - 36,178,203 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	32,364,662 - 32,367,187 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	33,442,820 - 33,445,714 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	33,443,186 - 33,445,709 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	33,790,619 - 33,793,188 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	52,446,817 - 52,449,342 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	32,019,786 - 32,022,301 (+)	NCBI		Celera
RGSC_v3.1	X	52,500,285 - 52,502,811 (+)	NCBI
Cytogenetic Map	X	q14	NCBI

S100G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	16,650,158 - 16,654,670 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	16,650,158 - 16,654,670 (+)	Ensembl			hg38	GRCh38
GRCh37	X	16,668,281 - 16,672,793 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	16,578,202 - 16,582,712 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	X	16,427,937 - 16,432,448	NCBI
Celera	X	20,786,679 - 20,791,190 (+)	NCBI		Celera
Cytogenetic Map	X	p22.2	NCBI
HuRef	X	14,422,857 - 14,427,585 (+)	NCBI		HuRef
CHM1_1	X	16,698,663 - 16,703,172 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	16,232,624 - 16,237,136 (+)	NCBI		T2T-CHM13v2.0

S100g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	161,744,988 - 161,747,595 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	161,744,988 - 161,747,595 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	162,961,992 - 162,964,599 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	162,961,992 - 162,964,599 (-)	Ensembl			mm10	GRCm38
MGSCv37	X	159,399,924 - 159,402,531 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	158,306,097 - 158,308,704 (-)	NCBI		MGSCv36	mm8
Celera	X	146,186,381 - 146,188,986 (-)	NCBI		Celera
Cytogenetic Map	X	F4	NCBI
cM Map	X	75.15	NCBI

S100g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955519	1,622,522 - 1,625,164 (-)	Ensembl
ChiLan1.0	NW_004955519	1,623,695 - 1,625,164 (-)	NCBI	ChiLan1.0	ChiLan1.0

S100G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	18,447,395 - 18,451,064 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	18,449,593 - 18,454,419 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	9,272,311 - 9,276,147 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	16,642,211 - 16,645,760 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	16,642,211 - 16,645,760 (+)	Ensembl			panPan2	panpan1.1

S100G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	12,808,234 - 12,813,696 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	12,808,718 - 12,812,972 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	12,659,893 - 12,664,199 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	12,771,897 - 12,776,208 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	12,771,404 - 12,776,325 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	12,839,790 - 12,844,092 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	12,826,177 - 12,830,481 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	12,853,701 - 12,858,003 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

S100g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	5,930,101 - 5,934,996 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	5,930,140 - 5,935,000 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	5,931,158 - 5,934,986 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

S100G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	13,107,402 - 13,114,213 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	X	13,107,611 - 13,114,213 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	14,053,102 - 14,059,701 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	X	p	NCBI

S100G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	15,082,230 - 15,087,327 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	15,083,524 - 15,087,004 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666056	16,933,822 - 16,937,577 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

S100g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624829	1,402,443 - 1,403,795 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624829	1,402,296 - 1,403,794 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

S100g
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	X	23,404,875 - 23,407,483 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in S100g
5 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	27
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000005622
Prediction methods:	Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598873	Memor2	Memory QTL 2	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	X	24470360	44931007	Rat
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	4001493	44939387	Rat
2290375	Gluco34	Glucose level QTL 34	2.75		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	24470360	45082063	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	8111486	53111486	Rat

Markers in Region

DXWox7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	31,706,555 - 31,706,768 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	33,443,850 - 33,444,060	NCBI	Rnor6.0
Rnor_5.0	X	33,791,313 - 33,791,523	UniSTS	Rnor5.0
RGSC_v3.4	X	52,447,480 - 52,447,693	RGD	RGSC3.4
RGSC_v3.4	X	52,447,481 - 52,447,693	UniSTS	RGSC3.4
Celera	X	32,020,450 - 32,020,652	UniSTS
RGSC_v3.1	X	52,500,949 - 52,501,162	RGD
RH 3.4 Map	X	451.3	UniSTS
RH 3.4 Map	X	451.3	RGD
RH 2.0 Map	21	345.6	RGD
Cytogenetic Map	X	q21	UniSTS

DXMgh12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	31,706,553 - 31,706,766 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	33,443,848 - 33,444,058	NCBI	Rnor6.0
Rnor_5.0	X	33,791,311 - 33,791,521	UniSTS	Rnor5.0
RGSC_v3.4	X	52,447,478 - 52,447,691	RGD	RGSC3.4
RGSC_v3.4	X	52,447,479 - 52,447,691	UniSTS	RGSC3.4
Celera	X	32,020,448 - 32,020,650	UniSTS
RGSC_v3.1	X	52,500,947 - 52,501,160	RGD
RH 3.4 Map	X	443.0	UniSTS
RH 3.4 Map	X	443.0	RGD
RH 2.0 Map	21	334.2	RGD
Cytogenetic Map	X	q21	UniSTS

DXWox15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	31,706,553 - 31,706,766 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	33,443,848 - 33,444,058	NCBI	Rnor6.0
Rnor_5.0	X	33,791,311 - 33,791,521	UniSTS	Rnor5.0
RGSC_v3.4	X	52,447,478 - 52,447,691	RGD	RGSC3.4
RGSC_v3.4	X	52,447,479 - 52,447,691	UniSTS	RGSC3.4
Celera	X	32,020,448 - 32,020,650	UniSTS
RGSC_v3.1	X	52,500,947 - 52,501,160	RGD
RH 3.4 Map	X	451.3	UniSTS
RH 3.4 Map	X	451.3	RGD
RH 2.0 Map	21	340.6	RGD
Cytogenetic Map	X	q21	UniSTS

DXWox38

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	X	35,338,344 - 35,338,563 (+)	Marker Load Pipeline
mRatBN7.2	X	31,706,561 - 31,706,780 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	33,443,856 - 33,444,072	NCBI	Rnor6.0
Rnor_5.0	X	33,791,319 - 33,791,535	UniSTS	Rnor5.0
RGSC_v3.4	X	52,447,487 - 52,447,705	UniSTS	RGSC3.4
Celera	X	32,020,456 - 32,020,664	UniSTS
Cytogenetic Map	X	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	9	11	70	86	87	59	25	59	1	206	52	3	55	71	66	28	5	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006256888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC059153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X16635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005622 ⟹ ENSRNOP00000005622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	35,337,675 - 35,340,205 (+)	Ensembl
mRatBN7.2 Ensembl	X	31,705,866 - 31,708,433 (+)	Ensembl
Rnor_6.0 Ensembl	X	33,443,186 - 33,445,709 (+)	Ensembl

RefSeq Acc Id:

NM_012521 ⟹ NP_036653

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	35,337,675 - 35,340,200 (+)	NCBI
mRatBN7.2	X	31,705,892 - 31,708,417 (+)	NCBI
Rnor_6.0	X	33,443,186 - 33,445,709 (+)	NCBI
Rnor_5.0	X	33,790,619 - 33,793,188 (+)	NCBI
RGSC_v3.4	X	52,446,817 - 52,449,342 (+)	RGD
Celera	X	32,019,786 - 32,022,301 (+)	RGD

Sequence:

show sequence

AGACCTCACCTGTTCCTGTCTGACTCTGGCAGCACTCACTGACAGCAAGCAGCACAGAAAAATG
AGCGCTAAGAAATCTCCCGAAGAAATGAAGAGCATTTTTCAAAAATATGCAGCCAAAGAAGGCG
ATCCAAACCAGCTGTCCAAGGAGGAGCTGAAGCTGCTGATTCAGTCAGAGTTCCCCAGCCTCCT
GAAGGCTTCAAGTACTCTAGACAATCTCTTTAAAGAGCTGGATAAGAACGGTGATGGAGAAGTT
AGCTATGAAGAATTCGAAGTTTTCTTCAAAAAGTTATCACAATGAAGCCAGAAGAAGGAGCTCC
GACACCACCTACTGATTGAATCCTATCCAATCCCAAAGATCTAGCTGTGAGAGCAAGATACTGT
TAATAAAGCAAATTCTGAGAC

hide sequence

RefSeq Acc Id:

XM_006256888 ⟹ XP_006256950

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	35,337,636 - 35,340,205 (+)	NCBI
mRatBN7.2	X	31,705,853 - 31,708,422 (+)	NCBI
Rnor_6.0	X	33,442,820 - 33,445,714 (+)	NCBI
Rnor_5.0	X	33,790,619 - 33,793,188 (+)	NCBI

Sequence:

show sequence

TTTTTAAAAGCCATGTATACTATCCCTCTGTGACGCATTTTTTTTTCTGAGTAGGAAAATTATT
GTCAAGCCTAAATCTGCAATTCCATTGCTTTTAGAAATGTGGACTGTGCGCAAGGTCAAAATTC
TATACTGAAGGGAAAATATGCTAAAGGAGAAGAAAAGCCAGGTTTTACCCTTGGGACTCTGAAC
CATTAAGCAATTGTTGAAGTAGCTCTCTATTGGAGCTTGACCTTAATTGAGAGTCTTAAGCTTG
GTCTCAGAAACCATTAATCATTACCCTTAAATAGTAAACAAAGGGAAATTTCATAATCAGGGTG
GTGTGTCTGTAAAGACTATAAAAGAGCTCCTCGTCGGCTCTTCATCAGACCTCACCTGTTCCTG
TCTGACTCTGGCAGCACTCACTGACAGCAAGCAGCACAGAAAAATGAGCGCTAAGAAATCTCCC
GAAGAAATGAAGAGCATTTTTCAAAAATATGCAGCCAAAGAAGGCGATCCAAACCAGCTGTCCA
AGGAGGAGCTGAAGCTGCTGATTCAGTCAGAGTTCCCCAGCCTCCTGAAGCAGGCTTCAAGTAC
TCTAGACAATCTCTTTAAAGAGCTGGATAAGAACGGTGATGGAGAAGTTAGCTATGAAGAATTC
GAAGTTTTCTTCAAAAAGTTATCACAATGAAGCCAGAAGAAGGAGCTCCGACACCACCTACTGA
TTGAATCCTATCCAATCCCAAAGATCTAGCTGTGAGAGCAAGATACTGTTAATAAAGCAAATTC
TGAGACATGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_036653	(Get FASTA)	NCBI Sequence Viewer
	XP_006256950	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40853	(Get FASTA)	NCBI Sequence Viewer
	AAA42333	(Get FASTA)	NCBI Sequence Viewer
	AAH59153	(Get FASTA)	NCBI Sequence Viewer
	CAA34627	(Get FASTA)	NCBI Sequence Viewer
	EDL90500	(Get FASTA)	NCBI Sequence Viewer
	EDL90501	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005622
GenBank Protein	P02634	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036653 ⟸ NM_012521
- UniProtKB:	P51964 (UniProtKB/Swiss-Prot), P02634 (UniProtKB/Swiss-Prot), A6K2N0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAKKSPEEMKSIFQKYAAKEGDPNQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKNGDGE VSYEEFEVFFKKLSQ hide sequence

RefSeq Acc Id:	XP_006256950 ⟸ XM_006256888
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q2C9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAKKSPEEMKSIFQKYAAKEGDPNQLSKEELKLLIQSEFPSLLKQASSTLDNLFKELDKNGDG EVSYEEFEVFFKKLSQ hide sequence

Ensembl Acc Id:

ENSRNOP00000005622 ⟸ ENSRNOT00000005622

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02634-F1-model_v2	AlphaFold	P02634	1-79	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701803

Promoter ID:

EPDNEW_R12327

Type:

single initiation site

Name:

S100g_1

Description:

S100 calcium binding protein G

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	33,443,186 - 33,443,246	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2253	AgrOrtholog
BioCyc Gene	G2FUF-2543	BioCyc
Ensembl Genes	ENSRNOG00000004222	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000005622	ENTREZGENE
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6917928	IMAGE-MGC_LOAD
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
	S-100_dom	UniProtKB/Swiss-Prot
	S100/CaBP-9k_CS	UniProtKB/Swiss-Prot
	S100_Ca-bd_sub	UniProtKB/Swiss-Prot
KEGG Report	rno:24249	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72928	IMAGE-MGC_LOAD
NCBI Gene	24249	ENTREZGENE
PANTHER	PTHR11639:SF73	UniProtKB/Swiss-Prot
	S100 CALCIUM-BINDING PROTEIN	UniProtKB/Swiss-Prot
Pfam	EF-hand_1	UniProtKB/Swiss-Prot
	S_100	UniProtKB/Swiss-Prot
PhenoGen	S100g	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
	S100_CABP	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004222	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
	S_100	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
TIGR	TC233052
UniProt	A0A8L2Q2C9	ENTREZGENE, UniProtKB/TrEMBL
	A6K2N0	ENTREZGENE, UniProtKB/TrEMBL
	P02634	ENTREZGENE
	P51964	ENTREZGENE
	S100G_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	P51964	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	S100g	S100 calcium binding protein G	Calb3	calbindin 3, (vitamin D-dependent calcium binding protein)	Symbol and Name updated	1299863	APPROVED
2004-09-10	Calb3	calbindin 3, (vitamin D-dependent calcium binding protein)		calbindin 3	Name updated	1299863	APPROVED
2002-11-06	Calb3	calbindin 3		calcium-binding protein, intestinal, vitamin D-dependent (9-kDa CaBP)	Name updated	625702	APPROVED
2002-06-10	Calb3	calcium-binding protein, intestinal, vitamin D-dependent (9-kDa CaBP)			Symbol and Name status set to approved	70586	APPROVED
2001-06-20	Cbpi	Calcium-binding protein, intestinal, vitamin D-dependent (9-kDa CaBP)			Symbol withdrawn, duplicate of Calb3 (RGD:2253)	67952	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in intestine	634681
gene_function	calcium-binding protein	634681
gene_process	may be involved in calcium metabolism in intestine	634681
gene_protein	79 amino acid protein	634681
gene_regulation	transcriptionally regulated by 1,25-dihydroxyvitamin D3	634681

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations