Symbol:
Bfsp1
Name:
beaded filament structural protein 1
RGD ID:
2205
Description:
Predicted to be a structural constituent of eye lens. Predicted to be involved in intermediate filament organization and lens fiber cell development. Predicted to act upstream of or within cell maturation. Predicted to be located in plasma membrane. Predicted to be active in cytoplasm and intermediate filament. Human ortholog(s) of this gene implicated in cataract 33. Orthologous to human BFSP1 (beaded filament structural protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
115-kDa; beaded filament structural protein 1 filensin; beaded filament structural protein 1, filensin; CP94; CP95; CP97; CP97 115-kDa; filensin; Filensin a cytoskeletal componenet (beaded filament) specific to the eye lens; lens fiber cell beaded-filament structural protein CP 94
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BFSP1 (beaded filament structural protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Bfsp1 (beaded filament structural protein 1, in lens-CP94) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bfsp1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BFSP1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BFSP1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bfsp1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BFSP1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BFSP1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bfsp1 (beaded filament structural protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bfsp1 (beaded filament structural protein 1, in lens-CP94)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BFSP1 (beaded filament structural protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bfsp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 151,648,588 - 151,706,153 (-) NCBI GRCr8 mRatBN7.2 3 131,195,087 - 131,252,668 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 131,195,087 - 131,229,337 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 135,118,796 - 135,153,286 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 143,702,870 - 143,737,362 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 141,406,079 - 141,440,571 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 137,935,345 - 137,992,652 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 137,935,345 - 137,969,658 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 144,374,721 - 144,424,049 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 132,268,138 - 132,302,378 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 132,173,710 - 132,207,951 (-) NCBI Celera 3 130,092,931 - 130,121,949 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bfsp1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Bfsp1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Bfsp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BFSP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BFSP1 mRNA CTD PMID:21296121 Bfsp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BFSP1 mRNA CTD PMID:33387578 Bfsp1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Bfsp1 (Mus musculus) 6480464 bisphenol S affects the methylation of BFSP1 gene CTD PMID:31683443 Bfsp1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BFSP1 mRNA CTD PMID:24780913 Bfsp1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BFSP1 mRNA CTD PMID:31881176 Bfsp1 Rat acrylamide decreases expression ISO Bfsp1 (Mus musculus) 6480464 Acrylamide results in decreased expression of BFSP1 mRNA CTD PMID:30807115 Bfsp1 Rat all-trans-retinoic acid decreases expression ISO BFSP1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of BFSP1 mRNA CTD PMID:23724009 Bfsp1 Rat aristolochic acid A increases expression ISO BFSP1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of BFSP1 mRNA CTD PMID:33212167 Bfsp1 Rat belinostat decreases expression ISO BFSP1 (Homo sapiens) 6480464 belinostat results in decreased expression of BFSP1 mRNA CTD PMID:27188386 Bfsp1 Rat benzo[a]pyrene affects methylation ISO BFSP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BFSP1 3' UTR more ... CTD PMID:27901495 and PMID:30157460 Bfsp1 Rat benzo[b]fluoranthene increases expression ISO Bfsp1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of BFSP1 mRNA CTD PMID:26377693 Bfsp1 Rat benzo[e]pyrene increases methylation ISO BFSP1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of BFSP1 intron CTD PMID:30157460 Bfsp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BFSP1 mRNA CTD PMID:25181051 Bfsp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BFSP1 gene CTD PMID:28505145 Bfsp1 Rat CGP 52608 multiple interactions ISO BFSP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BFSP1 gene] CTD PMID:28238834 Bfsp1 Rat copper(II) sulfate increases expression ISO BFSP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BFSP1 mRNA CTD PMID:19549813 Bfsp1 Rat DDE decreases expression ISO BFSP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of BFSP1 mRNA CTD PMID:38568856 Bfsp1 Rat Dibutyl phosphate affects expression ISO BFSP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BFSP1 mRNA CTD PMID:37042841 Bfsp1 Rat dinophysistoxin 1 decreases expression ISO BFSP1 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of BFSP1 mRNA CTD PMID:28939011 Bfsp1 Rat ethylparaben increases expression ISO BFSP1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of BFSP1 mRNA CTD PMID:37690743 Bfsp1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of BFSP1 mRNA CTD PMID:30307764 Bfsp1 Rat folic acid increases expression ISO Bfsp1 (Mus musculus) 6480464 Folic Acid results in increased expression of BFSP1 mRNA CTD PMID:25629700 Bfsp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BFSP1 mRNA CTD PMID:33387578 Bfsp1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of BFSP1 mRNA CTD PMID:29933104 Bfsp1 Rat hydrogen peroxide affects expression ISO BFSP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of BFSP1 mRNA CTD PMID:20044591 Bfsp1 Rat lipopolysaccharide multiple interactions ISO BFSP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of BFSP1 mRNA CTD PMID:35811015 Bfsp1 Rat methapyrilene increases methylation ISO BFSP1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of BFSP1 intron CTD PMID:30157460 Bfsp1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of BFSP1 gene CTD PMID:35440735 Bfsp1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BFSP1 mRNA CTD PMID:33387578 Bfsp1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO BFSP1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of BFSP1 mRNA CTD PMID:35811015 Bfsp1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO BFSP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of BFSP1 mRNA CTD PMID:35811015 Bfsp1 Rat sodium arsenite increases expression ISO BFSP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BFSP1 mRNA CTD PMID:29301061 and PMID:38568856 Bfsp1 Rat sunitinib decreases expression ISO BFSP1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of BFSP1 mRNA CTD PMID:31533062 Bfsp1 Rat testosterone decreases expression ISO BFSP1 (Homo sapiens) 6480464 Testosterone results in decreased expression of BFSP1 mRNA CTD PMID:33359661 Bfsp1 Rat titanium dioxide decreases methylation ISO Bfsp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BFSP1 gene CTD PMID:35295148 Bfsp1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of BFSP1 mRNA CTD PMID:33387578 Bfsp1 Rat triphenyl phosphate affects expression ISO BFSP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BFSP1 mRNA CTD PMID:37042841 Bfsp1 Rat Triptolide increases expression ISO Bfsp1 (Mus musculus) 6480464 triptolide results in increased expression of BFSP1 mRNA CTD PMID:32835833 Bfsp1 Rat triptonide increases expression ISO Bfsp1 (Mus musculus) 6480464 triptonide results in increased expression of BFSP1 mRNA CTD PMID:33045310 Bfsp1 Rat valproic acid decreases methylation ISO BFSP1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of BFSP1 gene CTD PMID:29154799 Bfsp1 Rat valproic acid affects expression ISO BFSP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of BFSP1 mRNA CTD PMID:25979313 Bfsp1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of BFSP1 mRNA CTD PMID:23869203 Bfsp1 Rat zoledronic acid decreases expression ISO BFSP1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of BFSP1 mRNA CTD PMID:24714768
2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) CGP 52608 (ISO) copper(II) sulfate (ISO) DDE (ISO) Dibutyl phosphate (ISO) dinophysistoxin 1 (ISO) ethylparaben (ISO) fenvalerate (EXP) folic acid (ISO) gentamycin (EXP) graphite (EXP) hydrogen peroxide (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methoxychlor (EXP) paracetamol (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) Triptolide (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Bfsp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 151,648,588 - 151,706,153 (-) NCBI GRCr8 mRatBN7.2 3 131,195,087 - 131,252,668 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 131,195,087 - 131,229,337 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 135,118,796 - 135,153,286 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 143,702,870 - 143,737,362 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 141,406,079 - 141,440,571 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 137,935,345 - 137,992,652 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 137,935,345 - 137,969,658 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 144,374,721 - 144,424,049 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 132,268,138 - 132,302,378 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 132,173,710 - 132,207,951 (-) NCBI Celera 3 130,092,931 - 130,121,949 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
BFSP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 17,493,905 - 17,569,220 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 17,493,905 - 17,569,220 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 17,474,550 - 17,549,865 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 17,422,550 - 17,459,974 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 17,422,550 - 17,459,974 NCBI Celera 20 17,549,027 - 17,614,092 (-) NCBI Celera Cytogenetic Map 20 p12.1 NCBI HuRef 20 17,437,512 - 17,512,555 (-) NCBI HuRef CHM1_1 20 17,474,583 - 17,549,870 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 17,544,579 - 17,619,878 (-) NCBI T2T-CHM13v2.0
Bfsp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 143,668,448 - 143,757,320 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 143,668,448 - 143,705,093 (-) Ensembl GRCm39 Ensembl GRCm38 2 143,826,528 - 143,915,219 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 143,826,528 - 143,863,173 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 143,652,264 - 143,688,909 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 143,517,969 - 143,554,614 (-) NCBI MGSCv36 mm8 Celera 2 145,009,411 - 145,046,263 (-) NCBI Celera Cytogenetic Map 2 G1 NCBI cM Map 2 70.89 NCBI
Bfsp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 26,507,528 - 26,535,551 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 26,507,381 - 26,535,545 (-) NCBI ChiLan1.0 ChiLan1.0
BFSP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 18,382,481 - 18,425,974 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 18,379,319 - 18,422,812 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 17,452,664 - 17,527,917 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 17,430,466 - 17,505,954 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 17,430,635 - 17,467,819 (-) Ensembl panpan1.1 panPan2
BFSP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 5,432,098 - 5,500,278 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 5,439,512 - 5,499,307 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 5,364,812 - 5,432,325 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 5,840,195 - 5,907,896 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 5,839,364 - 5,907,718 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 5,484,491 - 5,521,881 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 5,547,459 - 5,614,907 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 5,823,137 - 5,890,458 (+) NCBI UU_Cfam_GSD_1.0
Bfsp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 154,106,016 - 154,168,580 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 2,566,521 - 2,600,030 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 2,566,698 - 2,599,946 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BFSP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 25,933,900 - 25,967,005 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 25,933,743 - 25,966,940 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 29,343,023 - 29,376,119 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BFSP1
Bfsp1
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 34 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000007727 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
D3Rat8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 131,212,042 - 131,212,228 (+) MAPPER mRatBN7.2 Rnor_6.0 3 137,952,304 - 137,952,489 NCBI Rnor6.0 Rnor_5.0 3 144,391,680 - 144,391,865 UniSTS Rnor5.0 RGSC_v3.4 3 132,285,034 - 132,285,219 UniSTS RGSC3.4 RGSC_v3.4 3 132,285,033 - 132,285,219 RGD RGSC3.4 RGSC_v3.1 3 132,190,607 - 132,190,792 RGD Celera 3 130,109,887 - 130,110,072 UniSTS RH 3.4 Map 3 1184.6 RGD RH 3.4 Map 3 1184.6 UniSTS RH 2.0 Map 3 802.7 RGD SHRSP x BN Map 3 64.1499 RGD FHH x ACI Map 3 80.25 RGD Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007727 ⟹ ENSRNOP00000007727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 131,195,087 - 131,229,337 (-) Ensembl Rnor_6.0 Ensembl 3 137,935,345 - 137,969,658 (-) Ensembl
RefSeq Acc Id:
NM_031555 ⟹ NP_113743
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 151,648,588 - 151,682,837 (-) NCBI mRatBN7.2 3 131,195,087 - 131,229,337 (-) NCBI Rnor_6.0 3 137,935,345 - 137,969,658 (-) NCBI Rnor_5.0 3 144,374,721 - 144,424,049 (-) NCBI RGSC_v3.4 3 132,268,138 - 132,302,378 (-) RGD Celera 3 130,092,931 - 130,121,949 (-) NCBI
Sequence:
CTTCCGGGAGCCATGTACCGCCGCAGCTACGTCTTCCAGGCCCGCCAGGAGCGCTACGAGCGCGCCCAGCCCGCGGGCCCTACCGCCCAACCCGGAGGAACCGCGCCCGGCCTGGCGGCGCTGCAGGC
hide sequence
RefSeq Acc Id:
XM_006235117 ⟹ XP_006235179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 151,648,593 - 151,706,153 (-) NCBI mRatBN7.2 3 131,195,087 - 131,252,668 (-) NCBI Rnor_6.0 3 137,935,345 - 137,992,652 (-) NCBI Rnor_5.0 3 144,374,721 - 144,424,049 (-) NCBI
Sequence:
AGGGTCCCTTGCTGAATCTGGAGCTATGATGGCAGCAGAAAGCCCCAGGGATTTGTCCTATCTCCGTCCCTCACAGTGCTGGGTTACAGGTCCTAGCGGGCTATTGACTTTGGTCACATCAGTGTCAT
hide sequence
RefSeq Acc Id:
NP_113743 ⟸ NM_031555
- UniProtKB:
F1M8F1 (UniProtKB/TrEMBL)
- Sequence:
MYRRSYVFQARQERYERAQPAGPTAQPGGTAPGLAALQALGERVAAQVQRARALQQRHAGLRRQLYAFQRLGEQPGPEEALARHVEANLQRARDLAAEHARLERQEAEAQRALDEFRSKYENECECQL
hide sequence
RefSeq Acc Id:
XP_006235179 ⟸ XM_006235117
- Peptide Label:
isoform X1
- UniProtKB:
A6K736 (UniProtKB/TrEMBL)
- Sequence:
MRTWCSDLVLLGSFEGICAASGAAGSWAARRYENECECQLVLKEMLERLNKEADEALLRNLHLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000007727 ⟸ ENSRNOT00000007727
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-16
Bfsp1
beaded filament structural protein 1
Bfsp1
beaded filament structural protein 1, filensin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-01-29
Bfsp1
beaded filament structural protein 1, filensin
Bfsp1
beaded filament structural protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-11-05
Bfsp1
beaded filament structural protein 1
Bfsp1
beaded filament structural protein 1, filensin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-20
Bfsp1
beaded filament structural protein 1, filensin
Bfsp1
beaded filament structural protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-07-23
Bfsp1
Filensin
Name withdrawn
67952 WITHDRAWN
2001-07-23
Bfsp1
beaded filament structural protein 1, filensin
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
Note Type
Note
Reference
gene_expression
expressed only in the lens
631858
gene_homology
demonstrates significant homology with cytokeratins
631858
gene_protein
94kDa
631858
