Advanced Search (OLGA)

Gene: Rad51ap1 (RAD51 associated protein 1) Rattus norvegicus

Analyze

Symbol:

Rad51ap1

Name:

RAD51 associated protein 1

RGD ID:

1597431

Description:

Predicted to enable DNA binding activity and RNA binding activity. Predicted to be involved in DNA repair; cellular response to ionizing radiation; and positive regulation of DNA recombination. Predicted to act upstream of or within DNA recombination. Predicted to be located in chromatin and nucleus. Predicted to be part of protein-containing complex. Orthologous to human RAD51AP1 (RAD51 associated protein 1); INTERACTS WITH 1-naphthyl isothiocyanate; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC689055; MGC156698; RAD51-associated protein 1; similar to RAD51 associated protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAD51AP1 (RAD51 associated protein 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Rad51ap1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rad51ap1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAD51AP1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAD51AP1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rad51ap1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAD51AP1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAD51AP1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rad51ap1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rad51ap1 (RAD51 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rad51ap1 (RAD51 associated protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RAD51AP1 (RAD51 associated protein 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rad51ap1 (RAD51 associated protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rad51ap1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rad51ap1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	161,445,610 - 161,458,661 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	161,445,512 - 161,458,680 (-)	Ensembl				GRCr8
mRatBN7.2	4	159,759,454 - 159,772,473 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	159,759,459 - 159,772,524 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	165,989,245 - 166,002,194 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	161,772,158 - 161,785,107 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	160,406,193 - 160,419,142 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	159,469,803 - 159,482,869 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	159,469,804 - 159,482,869 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	232,130,924 - 232,143,990 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	163,308,788 - 163,321,854 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	148,475,373 - 148,488,439 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(2E,4E)-hexa-2,4-dienoic acid (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1,4-dioxane (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-butoxyethanol (ISO)

3-methylcholanthrene (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

8'-apo-beta,psi-caroten-8'-al (ISO)

acetamide (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

all-trans-retinoic acid (ISO)

anthracene-1,8,9-triol (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-carotene (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bleomycin A2 (ISO)

buta-1,3-diene (ISO)

butylated hydroxyanisole (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

DDE (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

diuron (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

genistein (ISO)

GSK-J4 (ISO)

imiquimod (ISO)

iron dichloride (ISO)

iron trichloride (ISO)

L-methionine (ISO)

lucanthone (ISO)

MeIQx (ISO)

methamphetamine (ISO)

methyl methanesulfonate (ISO)

Mezerein (ISO)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

ochratoxin A (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

palbociclib (ISO)

palytoxin (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctanoic acid (ISO)

phenacetin (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium nitrite (ISO)

sulfadimethoxine (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tebufenpyrad (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to ionizing radiation (ISO)

DNA damage response (ISO)

DNA recombination (ISO)

double-strand break repair via homologous recombination (IBA,ISO)

interstrand cross-link repair (IBA,ISO)

positive regulation of double-strand break repair via homologous recombination (ISO)

positive regulation of reciprocal meiotic recombination (ISO)

regulation of double-strand break repair via homologous recombination (ISO)

Cellular Component

chromatin (ISO)

chromosome (ISO)

nucleus (ISO)

protein-containing complex (ISO)

Molecular Function

D-loop DNA binding (ISO)

DNA binding (ISO)

DNA secondary structure binding (ISO)

double-stranded DNA binding (IBA,ISO)

protein binding (ISO)

RNA binding (ISO)

single-stranded DNA binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9192668	PMID:9396801	PMID:12477932	PMID:16990250	PMID:23754376	PMID:26323318

Genomics

Comparative Map Data

Rad51ap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	161,445,610 - 161,458,661 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	161,445,512 - 161,458,680 (-)	Ensembl				GRCr8
mRatBN7.2	4	159,759,454 - 159,772,473 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	159,759,459 - 159,772,524 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	165,989,245 - 166,002,194 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	161,772,158 - 161,785,107 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	160,406,193 - 160,419,142 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	159,469,803 - 159,482,869 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	159,469,804 - 159,482,869 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	232,130,924 - 232,143,990 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	163,308,788 - 163,321,854 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	148,475,373 - 148,488,439 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

RAD51AP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	4,538,890 - 4,560,047 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	4,538,798 - 4,560,254 (+)	Ensembl			hg38	GRCh38
GRCh37	12	4,648,056 - 4,669,213 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	4,518,317 - 4,539,475 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	4,518,316 - 4,539,475	NCBI
Celera	12	6,269,995 - 6,291,258 (+)	NCBI		Celera
Cytogenetic Map	12	p13.32	NCBI
HuRef	12	4,504,635 - 4,525,896 (+)	NCBI		HuRef
CHM1_1	12	4,647,572 - 4,668,835 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	4,545,677 - 4,566,834 (+)	NCBI		T2T-CHM13v2.0

Rad51ap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	126,900,378 - 126,916,664 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	126,900,013 - 126,916,550 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	126,923,415 - 126,939,621 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	126,923,050 - 126,939,587 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	126,873,437 - 126,889,573 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	126,889,705 - 126,905,168 (-)	NCBI		MGSCv36	mm8
Celera	6	128,597,764 - 128,618,928 (-)	NCBI		Celera
Cytogenetic Map	6	F3	NCBI
cM Map	6	61.92	NCBI

Rad51ap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	2,334,911 - 2,361,806 (+)	Ensembl
ChiLan1.0	NW_004955413	2,335,431 - 2,362,781 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAD51AP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	10,088,892 - 10,110,050 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	10,085,650 - 10,106,977 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	4,657,972 - 4,679,232 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	4,578,621 - 4,599,879 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	4,578,621 - 4,599,879 (+)	Ensembl			panPan2	panpan1.1

RAD51AP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	40,303,935 - 40,341,666 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	40,303,992 - 40,341,526 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	6,340,236 - 6,378,314 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	40,659,136 - 40,697,229 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	40,658,946 - 40,697,181 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	40,548,215 - 40,586,307 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	40,573,166 - 40,611,254 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	5,750,772 - 5,788,910 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rad51ap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	104,468,123 - 104,486,839 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936606	4,697,369 - 4,716,006 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAD51AP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	65,872,539 - 65,897,212 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	65,872,277 - 65,897,210 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	68,078,180 - 68,103,126 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAD51AP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	4,560,107 - 4,582,357 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	4,560,175 - 4,581,142 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	3,659,998 - 3,682,082 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rad51ap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	1,627,765 - 1,643,667 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624860	1,627,606 - 1,643,569 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rad51ap1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	20,966,639 - 20,979,701 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rad51ap1
67 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	64
Interacting mature miRNAs:	70
Transcripts:	ENSRNOT00000033983
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

RH142894

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	159,759,593 - 159,759,724 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	159,469,939 - 159,470,069	NCBI	Rnor6.0
Rnor_5.0	4	232,143,724 - 232,143,854	UniSTS	Rnor5.0
RGSC_v3.4	4	163,308,924 - 163,309,054	UniSTS	RGSC3.4
Celera	4	148,475,509 - 148,475,639	UniSTS
RH 3.4 Map	4	1008.6	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	161	91	90	59	88	59	6	350	187	11	140	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001079711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006237504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC128747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088333 ⟹ ENSRNOP00000073657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	161,445,622 - 161,458,680 (-)	Ensembl
mRatBN7.2 Ensembl	4	159,759,459 - 159,772,524 (-)	Ensembl
Rnor_6.0 Ensembl	4	159,469,804 - 159,482,869 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119755 ⟹ ENSRNOP00000085679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	161,445,512 - 161,458,680 (-)	Ensembl
mRatBN7.2 Ensembl	4	159,759,459 - 159,770,665 (-)	Ensembl

RefSeq Acc Id:

NM_001079711 ⟹ NP_001073179

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,559 (-)	NCBI
mRatBN7.2	4	159,759,454 - 159,772,403 (-)	NCBI
Rnor_6.0	4	159,469,803 - 159,482,869 (-)	NCBI
Rnor_5.0	4	232,130,924 - 232,143,990 (+)	NCBI
RGSC_v3.4	4	163,308,788 - 163,321,854 (-)	RGD
Celera	4	148,475,373 - 148,488,439 (-)	RGD

Sequence:

show sequence

TGCCCTGGCAAAGGTGTGTGCGCGCAGGCGCTCTTTCCTCAGTACGCAGGCGCCGCCTTAGGCA
GGAGAGCGATGATTGGTGGGCTGGCGTACCGGGGCGTGGAGCCCGACGTCTGGTTTTGGGCGGG
AATTGAAACCGCCACAGCTGCTCTCCAGCTCCAGGTCGCTGCTGTCCTAGGAAGGGCACCATGG
TGCGCCCTACCAGAAATAAAAAACCAGTCAATTATTCACAGTTTGAGGATTCTGGCAATGACTC
TGATGATGATTTTATTTCTGCATCTATACCTGTAAACAAGTCAAAAACCGTGCCAAAAGTGTTA
AAGCAAGACAAGCCAAAACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAAC
CCCCTAAAAAAAGGATGGCTTTAGATGACAAGGTCTTCCAGAGAGGCCTAGAAGTTGCCCTGGC
CTTATCTGTGAAGGAACTTCCAACACTCACCAACCAAGTGAAGAAGCCCGAAGAGAGAAGCACT
GACACAACCGGCAAAAGGAAAACGGAAAAGACAGATAAACCTCCTCGAGTCTCTAACTGCAGTG
TAGCCAGTGATGATGTAGATTTGAACAAGATCACAGAGGAGGGGGACGTCAGAGATGTTGAAGG
AGAGAGGAGAACAACATCTAAAGCCAGGGCTCAGCAGAGGAGGAAGCTCTCAGAAGGCAGCAGT
GGCAGCAGTGCTGACGGCACTGAGCCGGACAGTGCGACTGGTGAAGATTCAGAAAGTGATCCTG
ATTTTGATGAGAGTGAGGAAAGCGATGAAGACTTTGGTGTGAGAAGAGGTAAAGAAACAAAGAA
GAAACCAGTGCAGAAGAAACCCAAAGCAGAAAAGAAGGAAAGGAAATCAAAACCCAAACGTGAG
GAGGCATCAGTGACTTCAGCAGACCCAGCTCCAGCTGCCATCAAATCAGGATCTCCAGCCTTAC
CCCAGCCAGTTGGTCTTCCTTCCGAGGCCACTAGGAAACCAGCAAAAATATGCAGCCCTTCAGC
AGAAAGCAAGAGGCCCAAGTGGGTCCCCCCAGCCGCCTCCGGGAGCAGAAACTCTAGCAGCAGC
TCATGGGCAGGAACCCCCGCCAGGTCCCCGAGTCAGAGCCTGCGTCTGGGCCTCTCCCGATTAG
CACCAGTTAAGAGTTTGCATCCAAGTACCACAAGCAGCCAAGTACGGTAGCAGGAAAGGACCTC
TGAGACCCTTGGGACTGCAGAGCGGGTTGTCATATTCAGCGTCCACATAAAAGAACCTTTAATG
GATCACATGAAGGAGCTCTGTGTGATTCTGGTCTCATCAAAACCTTCTGCCCTTCAGCAAAGAT
TCTGGGGCCTCTCCTTGTGCCACTCCTGAAGAGTGAAGAGTGTGTTGTGTTTTCTTATGTTTCA
TAAGTCACCGTCACTCGGGCTTTGCGGCACATCGGCAATCACATGTCCTCCAACTCTGTCTGGC
AAAAGGGCATCCTGGGTTCCTTCAGGAGGCGTTTCTGAAATCTTTCCCATGCTACATTTCTGTA
GCTTTGTGAGAAGCTTGCTCTTTATCTAGGTCTTTTTTAGTGAGAGTTCTGCTTTTTGTACATA
TTAAAATGTCGACTGTACTGCAGCATGTGTCCCTCCGTGGGGACAGGTGGTTAGCGTGTAGCTG
ATCTTATAACACTGTATGAACTTCTCAATGTCAGACCCTTTAATAAGAGTGGAAAGGTTAAAAT
GCGCTCACTGATACCATGCGTCTCCGTGTGTCTGTTTGCTAATGTGAGTCTTGTGTGTCAGCAT
AAGCAAGGGGAAGTGGTGTCTTCACCTTAGATAAAGCCCGAGGTGAAAGACTGTCACCCCTGTC
ATCAGCTGATGCAGTTTCTCAAGAAGCTTAGATTTATTGTCAATAAAAATAATTATTTTTATGG
TGAGAATATCACTTATGGTGTTCCTGATCACTTTTTAATAAAAAAATTAATGGCTTACCAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001398921 ⟹ NP_001385850

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,559 (-)	NCBI
mRatBN7.2	4	159,759,454 - 159,772,403 (-)	NCBI

RefSeq Acc Id:

NM_001398922 ⟹ NP_001385851

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,559 (-)	NCBI
mRatBN7.2	4	159,759,454 - 159,772,403 (-)	NCBI

RefSeq Acc Id:

XM_006237504 ⟹ XP_006237566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,632 (-)	NCBI
mRatBN7.2	4	159,760,207 - 159,772,473 (-)	NCBI
Rnor_6.0	4	159,470,611 - 159,482,853 (-)	NCBI
Rnor_5.0	4	232,130,924 - 232,143,990 (+)	NCBI

Sequence:

show sequence

TGTGCGCGCAGGCGCTCTTTCCTCAGTACGCAGGCGCCGCCTTAGGCAGGAGAGCGATGATTGG
TGGGCTGGCGTACCGGGGCGTGGAGCCCGACGTCTGGTTTTGGGCGGGAATTGAAACCGCCACA
GCTGCTCTCCAGCTCCAGGTCGCTGCTGTCCTAGGAAGGGCACCATGGTGCGCCCTACCAGAAA
TAAAAAACCAGTCAATTATTCACAGTTTGAGGATTCTGGCAATGACTCTGATGATGATTTTATT
TCTGCATCTATACCTGTAAACAAGTCAAAAACCGTGCCAAAAGTGTTAAAGCAAGACAAGCCAA
AACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAACCCCCTAAAAAAAGGAT
GGCTTTAGATGACAAGGTCTTCCAGAGAGGCCTAGAAGTTGCCCTGGCCTTATCTGTGAAGGAA
CTTCCAACACTCACCAACCAAGTGAAGAAGCCCGAAGAGAGAAGCACTGACACAACCGGCAAAA
GGAAAACGGAAAAGACAGATAAACCTCCTCGAGTCTCTAACTGCAGTGTAGCCAGTGATGATGT
AGAAGATTTGAACAAGATCACAGAGGAGGGGGACGTCAGAGATGTTGAAGGAGAGAGGAGAACA
ACATCTAAAGCCAGGGCTCAGCAGAGGAGGAAGCTCTCAGAAGGCAGCAGTGGCAGCAGTGCTG
ACGGCACTGAGCCGGACAGTGCGACTGGTGAAGATTCAGAAAGTGATCCTGATTTTGATGAGAG
TGAGGAAAGCGATGAAGACTTTGGTGTGAGAAGAGGTAAAGAAACAAAGAAGAAACCAGTGCAG
AAGAAACCCAAAGCAGAAAAGAAGGAAAGGAAATCAAAACCCAAACGTGAGGAGGCATCAGTGA
CTTCAGCAGACCCAGCTCCAGCTGCCATCAAATCAGGATCTCCAGCCTTACCCCAGCCAGTTGG
TCTTCCTTCCGAGGCCACTAGGAAACCAGCAAAAATATGCAGCCCTTCAGCAGAAAGCAAGAGG
CCCAAGTGGGTCCCCCCAGCCAGAAAAGCTGAAGACTTTGAAGGCGTTGGAGTTGGGGGTTTCA
GATCAGGATGCTCCGCCTGCCTGTGCTCTTCCTGTTTGTCAGTCCGCCTCCGGGAGCAGAAACT
CTAGCAGCAGCTCATGGGCAGGAACCCCCGCCAGGTCCCCGAGTCAGAGCCTGCGTCTGGGCCT
CTCCCGATTAGCACCAGTTAAGAGTTTGCAT

hide sequence

RefSeq Acc Id:

XM_039108380 ⟹ XP_038964308

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,454,998 (-)	NCBI
mRatBN7.2	4	159,759,454 - 159,772,433 (-)	NCBI

RefSeq Acc Id:

XM_063286717 ⟹ XP_063142787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,661 (-)	NCBI

RefSeq Acc Id:

XM_063286718 ⟹ XP_063142788

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,632 (-)	NCBI

RefSeq Acc Id:

XM_063286719 ⟹ XP_063142789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	161,445,610 - 161,458,661 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001073179	(Get FASTA)	NCBI Sequence Viewer
	NP_001385850	(Get FASTA)	NCBI Sequence Viewer
	NP_001385851	(Get FASTA)	NCBI Sequence Viewer
	XP_006237566	(Get FASTA)	NCBI Sequence Viewer
	XP_038964308	(Get FASTA)	NCBI Sequence Viewer
	XP_063142787	(Get FASTA)	NCBI Sequence Viewer
	XP_063142788	(Get FASTA)	NCBI Sequence Viewer
	XP_063142789	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI28748	(Get FASTA)	NCBI Sequence Viewer
	EDM01822	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073657
	ENSRNOP00000073657.2
	ENSRNOP00000085679
	ENSRNOP00000085679.2

RefSeq Acc Id:	NP_001073179 ⟸ NM_001079711
- Peptide Label:	isoform 2
- UniProtKB:	A1A5P3 (UniProtKB/TrEMBL), A0A8I6GE54 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVRPTRNKKPVNYSQFEDSGNDSDDDFISASIPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPT EPPKKRMALDDKVFQRGLEVALALSVKELPTLTNQVKKPEERSTDTTGKRKTEKTDKPPRVSNC SVASDDVDLNKITEEGDVRDVEGERRTTSKARAQQRRKLSEGSSGSSADGTEPDSATGEDSESD PDFDESEESDEDFGVRRGKETKKKPVQKKPKAEKKERKSKPKREEASVTSADPAPAAIKSGSPA LPQPVGLPSEATRKPAKICSPSAESKRPKWVPPAASGSRNSSSSSWAGTPARSPSQSLRLGLSR LAPVKSLHPSTTSSQVR hide sequence

RefSeq Acc Id:

XP_006237566 ⟸ XM_006237504

- Peptide Label:

isoform X3

- Sequence:

show sequence

MVRPTRNKKPVNYSQFEDSGNDSDDDFISASIPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPT
EPPKKRMALDDKVFQRGLEVALALSVKELPTLTNQVKKPEERSTDTTGKRKTEKTDKPPRVSNC
SVASDDVEDLNKITEEGDVRDVEGERRTTSKARAQQRRKLSEGSSGSSADGTEPDSATGEDSES
DPDFDESEESDEDFGVRRGKETKKKPVQKKPKAEKKERKSKPKREEASVTSADPAPAAIKSGSP
ALPQPVGLPSEATRKPAKICSPSAESKRPKWVPPARKAEDFEGVGVGGFRSGCSACLCSSCLSV
RLREQKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000073657 ⟸ ENSRNOT00000088333

RefSeq Acc Id:	XP_038964308 ⟸ XM_039108380
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000085679 ⟸ ENSRNOT00000119755

RefSeq Acc Id:	NP_001385851 ⟸ NM_001398922
- Peptide Label:	isoform 3
- UniProtKB:	A0A8I6GE54 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385850 ⟸ NM_001398921
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I6GE54 (UniProtKB/TrEMBL), A6ILW7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063142789 ⟸ XM_063286719
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063142787 ⟸ XM_063286717
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GE54 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063142788 ⟸ XM_063286718
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GE54 (UniProtKB/TrEMBL)

Protein Domains

RAD51 interacting motif

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1A5P3-F1-model_v2	AlphaFold	A1A5P3	1-337	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1597431	AgrOrtholog
BioCyc Gene	G2FUF-42958	BioCyc
Ensembl Genes	ENSRNOG00000059878	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088333	ENTREZGENE
	ENSRNOT00000088333.3	UniProtKB/TrEMBL
	ENSRNOT00000119755	ENTREZGENE
	ENSRNOT00000119755.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7099220	IMAGE-MGC_LOAD
InterPro	HR_DNA-Binding_Protein	UniProtKB/TrEMBL
	RAD51_interact	UniProtKB/TrEMBL
KEGG Report	rno:689055	UniProtKB/TrEMBL
MGC_CLONE	MGC:156698	IMAGE-MGC_LOAD
NCBI Gene	689055	ENTREZGENE
PANTHER	PTHR15361:SF4	UniProtKB/TrEMBL
	RAD51/NUKS-INTERACTING PROTEIN	UniProtKB/TrEMBL
Pfam	RAD51_interact	UniProtKB/TrEMBL
PhenoGen	Rad51ap1	PhenoGen
RatGTEx	ENSRNOG00000059878	RatGTEx
UniProt	A0A0G2K634_RAT	UniProtKB/TrEMBL
	A0A8I6GE54	ENTREZGENE, UniProtKB/TrEMBL
	A1A5P3	ENTREZGENE, UniProtKB/TrEMBL
	A6ILW7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Rad51ap1	RAD51 associated protein 1	LOC689055	similar to RAD51 associated protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC689055	similar to RAD51 associated protein 1	LOC683109	similar to RAD51 associated protein 1	Data merged from RGD:1590457	1643240	APPROVED
2006-11-20	LOC689055	similar to RAD51 associated protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC683109	similar to RAD51 associated protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message