Rpp30 (ribonuclease P/MRP subunit p30)

Gene: Rpp30 (ribonuclease P/MRP subunit p30) Rattus norvegicus

Analyze

Symbol:

Rpp30

Name:

ribonuclease P/MRP subunit p30

RGD ID:

1595116

Description:

Predicted to enable ribonuclease P RNA binding activity. Predicted to contribute to ribonuclease P activity. Predicted to be involved in tRNA 5'-leader removal. Predicted to be part of nucleolar ribonuclease P complex and ribonuclease MRP complex. Orthologous to human RPP30 (ribonuclease P/MRP subunit p30); PARTICIPATES IN tRNA maturation pathway; ribosome biogenesis pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC685332; MGC187977; ribonuclease P protein subunit p30; ribonuclease P/MRP 30 ; ribonuclease P/MRP 30 subunit; ribonuclease P/MRP 30 subunit (human); ribonuclease P/MRP subunit; similar to Ribonuclease P protein subunit p30 (RNaseP protein p30) (RNase P subunit 2)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPP30 (ribonuclease P/MRP subunit p30)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpp30 (ribonuclease P/MRP 30 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpp30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPP30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPP30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpp30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPP30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPP30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpp30 (ribonuclease P/MRP subunit p30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPP30 (ribonuclease P/MRP subunit p30)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpp30 (ribonuclease P/MRP 30 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpp30 (ribonuclease P/MRP 30 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	H35B03.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rpp30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpp30	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	243,198,647 - 243,221,559 (+)	NCBI		GRCr8
mRatBN7.2	1	233,786,048 - 233,808,958 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	233,786,099 - 233,808,952 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	242,183,324 - 242,205,801 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	249,099,926 - 249,122,780 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	241,938,084 - 241,960,936 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	254,697,247 - 254,720,093 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	254,697,247 - 254,720,087 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	262,053,592 - 262,076,260 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	240,286,366 - 240,309,222 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	230,885,463 - 230,908,059 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

crocidolite asbestos (ISO)

deoxynivalenol (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

glyphosate (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

lead diacetate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

ochratoxin A (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

resveratrol (ISO)

thioacetamide (EXP)

topotecan (EXP)

trimellitic anhydride (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

tRNA 5'-leader removal (ISO)

tRNA processing (IBA)

Cellular Component

multimeric ribonuclease P complex (ISO)

nucleolar ribonuclease P complex (IBA)

ribonuclease MRP complex (ISO)

Molecular Function

protein binding (ISO)

ribonuclease P activity (ISO)

ribonuclease P RNA binding (ISO)

RNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

RNA transport pathway (IEA)

tRNA maturation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Unexpected diversity of RNase P, an ancient tRNA processing enzyme: challenges and prospects.	Lai LB, etal., FEBS Lett. 2010 Jan 21;584(2):287-96. doi: 10.1016/j.febslet.2009.11.048. Epub .
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:16723659	PMID:22658674	PMID:30454648

Genomics

Comparative Map Data

Rpp30
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	243,198,647 - 243,221,559 (+)	NCBI		GRCr8
mRatBN7.2	1	233,786,048 - 233,808,958 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	233,786,099 - 233,808,952 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	242,183,324 - 242,205,801 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	249,099,926 - 249,122,780 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	241,938,084 - 241,960,936 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	254,697,247 - 254,720,093 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	254,697,247 - 254,720,087 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	262,053,592 - 262,076,260 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	240,286,366 - 240,309,222 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	230,885,463 - 230,908,059 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

RPP30
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	90,871,974 - 90,908,556 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	90,871,952 - 90,908,553 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	92,631,731 - 92,668,313 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	92,621,689 - 92,658,292 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	92,621,254 - 92,651,926	NCBI
Celera	10	86,378,161 - 86,414,769 (+)	NCBI		Celera
Cytogenetic Map	10	q23.31	NCBI
HuRef	10	86,260,723 - 86,297,333 (+)	NCBI		HuRef
CHM1_1	10	92,909,555 - 92,946,159 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	91,755,650 - 91,792,233 (+)	NCBI		T2T-CHM13v2.0

Rpp30
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	36,061,118 - 36,082,173 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	36,061,116 - 36,082,177 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	36,083,689 - 36,104,773 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	36,083,716 - 36,104,777 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	36,158,206 - 36,179,263 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	36,148,875 - 36,169,917 (+)	NCBI		MGSCv36	mm8
Celera	19	36,859,168 - 36,880,210 (+)	NCBI		Celera
Cytogenetic Map	19	C2	NCBI
cM Map	19	30.41	NCBI

Rpp30
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	2,273,980 - 2,303,314 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	2,276,006 - 2,302,882 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPP30
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	102,898,068 - 102,942,388 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	102,903,372 - 102,947,774 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	87,611,699 - 87,646,239 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	91,138,993 - 91,171,848 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	91,138,993 - 91,170,517 (+)	Ensembl	panpan1.1		panPan2

RPP30
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	5,535,257 - 5,563,820 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	5,535,709 - 5,562,502 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	5,702,828 - 5,731,402 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	5,755,638 - 5,784,265 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	5,756,007 - 5,784,125 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	5,512,723 - 5,541,292 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	5,551,517 - 5,580,105 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	5,717,205 - 5,745,776 (+)	NCBI		UU_Cfam_GSD_1.0

Rpp30
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	41,887,463 - 41,916,620 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936601	3,517,881 - 3,549,212 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936601	3,520,066 - 3,549,189 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPP30
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	102,566,046 - 102,597,121 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	102,565,802 - 102,606,046 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	111,677,217 - 111,708,315 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPP30
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	84,208,181 - 84,237,067 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	84,208,199 - 84,236,957 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	44,917,938 - 44,946,814 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpp30
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	2,086,748 - 2,114,618 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	2,087,357 - 2,114,878 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpp30
175 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	48
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000025412
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	0.00000081	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat

Markers in Region

RH139025

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	233,804,250 - 233,805,282 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	254,715,387 - 254,716,418	NCBI	Rnor6.0
Rnor_5.0	1	262,057,267 - 262,058,298	UniSTS	Rnor5.0
RGSC_v3.4	1	240,304,516 - 240,305,547	UniSTS	RGSC3.4
Celera	1	230,903,353 - 230,904,384	UniSTS
RH 3.4 Map	3	917.1	UniSTS
Cytogenetic Map	1	q53	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	32	20	19	20	3	5	74	26	41	11	3
Low		8	25	21		21	5	6		9			5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005492258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005492259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000025412 ⟹ ENSRNOP00000025413

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	233,786,112 - 233,808,952 (+)	Ensembl
Rnor_6.0 Ensembl	1	254,697,247 - 254,720,087 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097535 ⟹ ENSRNOP00000090910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	233,786,112 - 233,808,952 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107919 ⟹ ENSRNOP00000095685

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	233,786,112 - 233,808,952 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110649 ⟹ ENSRNOP00000091750

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	233,786,099 - 233,808,641 (+)	Ensembl

RefSeq Acc Id:

NM_001191083 ⟹ NP_001178012

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,198,713 - 243,221,559 (+)	NCBI
mRatBN7.2	1	233,786,112 - 233,808,958 (+)	NCBI
Rnor_6.0	1	254,697,247 - 254,720,093 (+)	NCBI
Rnor_5.0	1	262,053,592 - 262,076,260 (-)	NCBI
Celera	1	230,885,463 - 230,908,059 (+)	NCBI

Sequence:

show sequence

ATGTCAGCATGGCGGCGTTCGCAGATTTGGATCTAAGAGCGGGCTCAGACCTGAAGGCTCTGCG
CGGACTCGTGGAGACCGCTGCTCACCTGGGATACTCAGTTGTTGCCATCAATCACATTGTTGAC
TTTAAGGAAAAGAAACGGGAAATTGAAAAGCCAGTAGCAGTTTCTGAGCTCTTCACAACTTTAC
CAATTGTACAGGGAAAATCAAGACCAATTAAAATTTTAACTAGATTGACAATTATAGTTACAGA
TCCGTCTCACTGTAATGTTTTGAGAGCAACTTCTTCAAGGGTCCGGCTGTATGATATTGTTGCA
GTGTTTCCAAAGACAGAAAAACTTTTTCATGTTGCTTGTACACACTTAGATGTGGATTTAGTCT
GTATCACCGTAACAGAGAAATTACCATTTTACTTCAAAAGACCTCCTATTAATGTGGCGATCGA
GCGAGGCCTGGGCTTTGAGCTGGTCTATGGTCCTGCTATCAGAGACGCAACCATGAGAAGGTAC
ACAATCTCCAATGCCCTCAATCTGATGCAGATCTGCAAAGGAAAGAACGTAATTCTGTCCAGTG
CTGCAGAAAGGCCTTTGGAAATAAGAGGACCATATGACGTGGCCAACTTAGGGCTGCTGTTCGG
GCTGTCCGAAAATGAAGGCAAGGCTGCCGTGTCCACAAACTGCCGAGCTGCATTTCTCCATGGA
GAAACTAGGAAAACTGCTTTTGGAATTATTTCTACAGTGAAGAAGCCCCGGTCATCAGAAGCAG
AGGATGAATCTCTTCCAGCGTGCAAGAAAGCTAAACATGAGGGCTGAGGAGACAGCCTGAGTCT
CCATCACGCTGCTCCTCCCCTCACAGCTCATCAGTCACTGCAAATACACTCCGCTCGGCTGACG
TTTTCACTAAACTAGAAACCAAGTCTATAAAAACAGCTTCATATTCAGACATTAAAACAGCAAA
TAAAACCCAGTGAAGCATTTTTAAAGACTAACGATTAATTTAGATATACTTTTAAAAGAAAAAC
TATTACCCTTCATGTGAGTAATGAATAGCAGTAGGTGCACTGAAACAAGATGTCTCGATATTGT
AAAATATTGAAAAATAATAAATTAATGTTTTTTGTTCTTGGTACATATGGATTTGTAACTTTTA
CTATCCCAAAAAGTGGTTATTTTGAAGACTTAAGCTCTGTTGTGCAGGTGACTTTAACCAACTG
ATTATGTTTTAAGCTCTTTGATGTCCTGCTCGGGTTAAAGCCTTTCTGAAGGCCTCCTGGACCT
GTGAAAGGAGAAGGGCACTCACAAGAGTTGCTTATCCCCTCTATGTGCTCCCTCCTGCCTTCAA
GTTGTCCTGAAGACATATTCCTCCCTTTAGTTAGACATCATTCAGTAGCTAATACTGATTTTCC
TAGTTGCTATAGGTTTAAAGCATTTGGCTCAAAAAA

hide sequence

RefSeq Acc Id:

XM_039090942 ⟹ XP_038946870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,205,259 - 243,221,246 (+)	NCBI
mRatBN7.2	1	233,791,561 - 233,808,645 (+)	NCBI

RefSeq Acc Id:

XM_063273885 ⟹ XP_063129955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,215,707 - 243,221,246 (+)	NCBI

RefSeq Acc Id:

XM_063273886 ⟹ XP_063129956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,205,519 - 243,221,246 (+)	NCBI

RefSeq Acc Id:

XM_063273887 ⟹ XP_063129957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,198,647 - 243,209,718 (+)	NCBI

RefSeq Acc Id:

XR_005492258

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,198,648 - 243,218,608 (+)	NCBI
mRatBN7.2	1	233,786,049 - 233,808,413 (+)	NCBI

RefSeq Acc Id:

XR_005492259

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	243,198,647 - 243,209,718 (+)	NCBI
mRatBN7.2	1	233,786,048 - 233,797,153 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178012	(Get FASTA)	NCBI Sequence Viewer
	XP_038946870	(Get FASTA)	NCBI Sequence Viewer
	XP_063129955	(Get FASTA)	NCBI Sequence Viewer
	XP_063129956	(Get FASTA)	NCBI Sequence Viewer
	XP_063129957	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025413
	ENSRNOP00000025413.3
	ENSRNOP00000090910.1
	ENSRNOP00000091750.1
	ENSRNOP00000095685.1

RefSeq Acc Id:

NP_001178012 ⟸ NM_001191083

- UniProtKB:

D3ZU51 (UniProtKB/TrEMBL), A0A8I6GJ86 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKREIEKPVAVSELFTTLPIV
QGKSRPIKILTRLTIIVTDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHLDVDLVCIT
VTEKLPFYFKRPPINVAIERGLGFELVYGPAIRDATMRRYTISNALNLMQICKGKNVILSSAAE
RPLEIRGPYDVANLGLLFGLSENEGKAAVSTNCRAAFLHGETRKTAFGIISTVKKPRSSEAEDE
SLPACKKAKHEG

hide sequence

RefSeq Acc Id:

ENSRNOP00000025413 ⟸ ENSRNOT00000025412

RefSeq Acc Id:	XP_038946870 ⟸ XM_039090942
- Peptide Label:	isoform X2

RefSeq Acc Id:

ENSRNOP00000095685 ⟸ ENSRNOT00000107919

RefSeq Acc Id:

ENSRNOP00000091750 ⟸ ENSRNOT00000110649

RefSeq Acc Id:

ENSRNOP00000090910 ⟸ ENSRNOT00000097535

RefSeq Acc Id:	XP_063129957 ⟸ XM_063273887
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063129956 ⟸ XM_063273886
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063129955 ⟸ XM_063273885
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZU51-F1-model_v2	AlphaFold	D3ZU51	1-268	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690870

Promoter ID:

EPDNEW_R1395

Type:

multiple initiation site

Name:

Rpp30_1

Description:

ribonuclease P/MRP subunit p30

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	254,697,236 - 254,697,296	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1595116	AgrOrtholog
BioCyc Gene	G2FUF-55832	BioCyc
Ensembl Genes	ENSRNOG00000018718	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025412	ENTREZGENE
	ENSRNOT00000025412.5	UniProtKB/TrEMBL
	ENSRNOT00000097535.1	UniProtKB/TrEMBL
	ENSRNOT00000107919.1	UniProtKB/TrEMBL
	ENSRNOT00000110649.1	UniProtKB/TrEMBL
Gene3D-CATH	Metal-dependent hydrolases	UniProtKB/TrEMBL
InterPro	Pol/histidinol_Pase-like	UniProtKB/TrEMBL
	RNase_P_p30	UniProtKB/TrEMBL
KEGG Report	rno:685332	UniProtKB/TrEMBL
NCBI Gene	685332	ENTREZGENE
PANTHER	RIBONUCLEASE P PROTEIN SUBUNIT P30	UniProtKB/TrEMBL
	RNase_P_p30	UniProtKB/TrEMBL
Pfam	RNase_P_p30	UniProtKB/TrEMBL
PhenoGen	Rpp30	PhenoGen
RatGTEx	ENSRNOG00000018718	RatGTEx
Superfamily-SCOP	PHP-like	UniProtKB/TrEMBL
UniProt	A0A8I6AG83_RAT	UniProtKB/TrEMBL
	A0A8I6APH8_RAT	UniProtKB/TrEMBL
	A0A8I6GJ86	ENTREZGENE, UniProtKB/TrEMBL
	D3ZU51	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-11-29	Rpp30	ribonuclease P/MRP subunit p30	Rpp30	ribonuclease P/MRP 30 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-11-12	Rpp30	ribonuclease P/MRP 30 subunit	Rpp30	ribonuclease P/MRP subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-02-27	Rpp30	ribonuclease P/MRP subunit	Rpp30	ribonuclease P/MRP 30 subunit (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Rpp30	ribonuclease P/MRP 30 subunit (human)	LOC687772	similar to Ribonuclease P protein subunit p30 (RNaseP protein p30) (RNase P subunit 2)	Data merged from RGD:1597513	1643240	APPROVED
2008-05-15	Rpp30	ribonuclease P/MRP 30 subunit (human)	Rpp30	ribonuclease P/MRP 30	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Rpp30	ribonuclease P/MRP 30	LOC685332	similar to Ribonuclease P protein subunit p30 (RNaseP protein p30) (RNase P subunit 2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC685332	similar to Ribonuclease P protein subunit p30 (RNaseP protein p30) (RNase P subunit 2)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC687772	similar to Ribonuclease P protein subunit p30 (RNaseP protein p30) (RNase P subunit 2)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)