Advanced Search (OLGA)

Gene: C1ql2 (complement C1q like 2) Rattus norvegicus

Analyze

Symbol:

C1ql2

Name:

complement C1q like 2

RGD ID:

1594583

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in neurotransmitter receptor localization to postsynaptic specialization membrane; postsynaptic density assembly; and regulation of synapse maturation. Predicted to be located in extracellular region. Predicted to be part of protein-containing complex. Predicted to be active in cerebellar climbing fiber to Purkinje cell synapse; hippocampal mossy fiber to CA3 synapse; and synaptic cleft. Orthologous to human C1QL2 (complement C1q like 2); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Adii; adiponectin i; complement C1q-like protein 2; complement component 1, q subcomponent-like 2; LOC288979; similar to Cerebellin-2 precursor (Cerebellin-like protein)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C1QL2 (complement C1q like 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Mus musculus (house mouse):	C1ql2 (complement component 1, q subcomponent-like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C1ql2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C1QL2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C1QL2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C1ql2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C1QL2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C1QL2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C1ql2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	C1ql2 (complement C1q like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MLEC (malectin)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	C1QL2 (complement C1q like 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	C1ql2 (complement component 1, q subcomponent-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c1ql2 (complement component 1, q subcomponent-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c1ql2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	34,023,902 - 34,025,437 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	34,023,177 - 34,026,020 (+)	Ensembl				GRCr8
mRatBN7.2	13	31,471,150 - 31,472,685 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	31,471,150 - 31,472,689 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	34,038,150 - 34,039,685 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	35,326,000 - 35,327,535 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	32,600,426 - 32,601,961 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	36,378,187 - 36,379,722 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	36,378,356 - 36,380,302 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	41,484,469 - 41,486,004 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	13	31,353,153 - 31,354,688 (+)	NCBI		Celera
Cytogenetic Map	13	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

copper atom (EXP)

copper(0) (EXP)

dibutyl phthalate (EXP)

dimethylarsinic acid (EXP)

lipopolysaccharide (ISO)

malathion (ISO)

mono(2-ethylhexyl) phthalate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maintenance of synapse structure (IBA)

neurotransmitter receptor localization to postsynaptic specialization membrane (IEA,ISO)

postsynaptic density assembly (IEA,ISO)

regulation of synapse maturation (IEA,ISO)

trans-synaptic signaling, modulating synaptic transmission (IBA)

Cellular Component

cerebellar climbing fiber to Purkinje cell synapse (IEA,ISO)

extracellular region (IEA,ISO)

extracellular space (IBA)

glutamatergic synapse (IEA,ISO)

hippocampal mossy fiber to CA3 synapse (IEA,ISO)

protein-containing complex (IEA,ISO)

synapse (IBA)

synaptic cleft (IBA,IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18783346

Genomics

Comparative Map Data

C1ql2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	34,023,902 - 34,025,437 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	34,023,177 - 34,026,020 (+)	Ensembl				GRCr8
mRatBN7.2	13	31,471,150 - 31,472,685 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	31,471,150 - 31,472,689 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	34,038,150 - 34,039,685 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	35,326,000 - 35,327,535 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	32,600,426 - 32,601,961 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	36,378,187 - 36,379,722 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	36,378,356 - 36,380,302 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	41,484,469 - 41,486,004 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	13	31,353,153 - 31,354,688 (+)	NCBI		Celera
Cytogenetic Map	13	q11	NCBI

C1QL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	119,156,243 - 119,158,751 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	119,156,243 - 119,158,751 (-)	Ensembl			hg38	GRCh38
GRCh37	2	119,913,819 - 119,916,327 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	119,630,289 - 119,632,941 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	119,630,051 - 119,632,695	NCBI
Celera	2	113,239,899 - 113,242,551 (-)	NCBI		Celera
Cytogenetic Map	2	q14.2	NCBI
HuRef	2	112,238,462 - 112,240,902 (-)	NCBI		HuRef
CHM1_1	2	119,917,369 - 119,920,020 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	119,589,784 - 119,592,291 (-)	NCBI		T2T-CHM13v2.0

C1ql2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	120,268,312 - 120,270,903 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	120,268,312 - 120,270,903 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	120,340,582 - 120,343,174 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	120,340,582 - 120,343,174 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	122,237,159 - 122,239,751 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	122,168,128 - 122,170,720 (+)	NCBI		MGSCv36	mm8
Celera	1	123,003,911 - 123,006,502 (+)	NCBI		Celera
Cytogenetic Map	1	E2.3	NCBI
cM Map	1	52.68	NCBI

C1ql2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955459	10,568,359 - 10,573,078 (+)	Ensembl
ChiLan1.0	NW_004955459	10,569,064 - 10,571,064 (+)	NCBI	ChiLan1.0	ChiLan1.0

C1QL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	21,165,568 - 21,169,692 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	21,180,541 - 21,184,668 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	6,097,758 - 6,102,622 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	119,679,281 - 119,682,993 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	119,679,840 - 119,686,120 (-)	Ensembl			panPan2	panpan1.1

C1QL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	30,863,165 - 30,865,292 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	30,863,214 - 30,865,716 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	31,127,704 - 31,129,941 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	32,248,094 - 32,250,331 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	32,247,251 - 32,250,596 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	30,934,462 - 30,936,699 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	31,100,880 - 31,103,129 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	32,287,664 - 32,289,901 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

C1ql2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	90,416,998 - 90,419,521 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	51,198,719 - 51,201,308 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	51,198,074 - 51,200,751 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1QL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	24,674,861 - 24,677,094 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	24,674,175 - 24,676,961 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	28,311,266 - 28,313,370 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C1QL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	11,162,712 - 11,165,634 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	11,163,604 - 11,165,073 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666061	11,521,279 - 11,523,923 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C1ql2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	26,032,021 - 26,034,552 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624732	26,031,010 - 26,034,163 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C1ql2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	12,924,534 - 12,927,148 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C1ql2
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	46
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000071305
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2317027	Aia22	Adjuvant induced arthritis QTL 22	2.29		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	13	1	34785618	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
2317034	Aia9	Adjuvant induced arthritis QTL 9	4.62		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12285517	34884386	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	12448421	47969993	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2303030	Bp327	Blood pressure QTL 327			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	43736554	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
2317044	Aia23	Adjuvant induced arthritis QTL 23	2.3		joint integrity trait (VT:0010548)	ankle joint diameter (CMO:0002148)	13	12285517	34884386	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	6002008	47359539	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	3088755	48088755	Rat
631672	Iddm12	Insulin dependent diabetes mellitus QTL 12	2.2	0.0032	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	6002008	37088115	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
738036	Lnnr4	Liver neoplastic nodule remodeling QTL 4	3.64		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	1	34785618	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Markers in Region

C1ql2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	31,471,788 - 31,472,685 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	36,378,826 - 36,379,722	NCBI	Rnor6.0
Rnor_5.0	13	41,485,108 - 41,486,004	UniSTS	Rnor5.0
Celera	13	31,353,792 - 31,354,688	UniSTS
Cytogenetic Map	13	q11	UniSTS

C1ql2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	31,471,238 - 31,472,685 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	36,378,276 - 36,379,722	NCBI	Rnor6.0
Rnor_5.0	13	41,484,558 - 41,486,004	UniSTS	Rnor5.0
Celera	13	31,353,242 - 31,354,688	UniSTS
Cytogenetic Map	13	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	1	3	110	13	16	1	13	1	6	22	17	104	2	42	15	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT963075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000071305 ⟹ ENSRNOP00000066827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	34,023,177 - 34,026,020 (+)	Ensembl
mRatBN7.2 Ensembl	13	31,471,150 - 31,472,689 (+)	Ensembl
Rnor_6.0 Ensembl	13	36,378,356 - 36,380,302 (+)	Ensembl

RefSeq Acc Id:

NM_001105949 ⟹ NP_001099419

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	34,023,902 - 34,025,437 (+)	NCBI
mRatBN7.2	13	31,471,150 - 31,472,685 (+)	NCBI
Rnor_6.0	13	36,378,187 - 36,379,722 (+)	NCBI
Rnor_5.0	13	41,484,469 - 41,486,004 (+)	NCBI
Celera	13	31,353,153 - 31,354,688 (+)	RGD

Sequence:

show sequence

GCGGCAAGGAGGAGCTGGTGGCGGTCGCCTCCCGGCTGTGGCAGCGGCGGCGGCGCGCCTGCTT
GGCGGCCGTCGGCGTGCTCCTGGCCATGGCACTGGGGCTGCTAATCGCGGTGCCTCTGCTACTG
CAGGCGGCGCCCCCAGGAGCGGCTCACTACGAGATGCTGGGCACCTGCCGCATGATCTGTGACC
CGTACACCGTCTCTCCCGCAGGGGGACCCGCGGGCGCCAAGGCTCCACCGCCCGGGCCCAGTAC
CGCTGCCCTGGAAGTTATGCAGGACCTCAGCGCCAACCCCCCGCCTCCGTTTATCCAGGGACCA
AAGGGTGATCCGGGCCGACCAGGCAAGCCCGGGCCTCGGGGTCCTCCTGGAGAGCCAGGGCCTC
CTGGACCCAGGGGTCCCCCGGGAGAGAAGGGAGACTCGGGGAGGCCAGGGCTACCCGGACTGCA
GTTGACAACTAGCGCAGCCGGTGGCGTTGGTGTGGTGGGTGGCGGAACCGGGGGCGGTGGTGAC
ACAGAGGGAGAAGTGACCAGTGCGCTGAGTGCTGCCTTCAGCGGTCCCAAGATTGCCTTCTACG
TGGGACTCAAGAGCCCCCACGAAGGTTACGAGGTGCTCAAGTTCGACGACGTGGTCACCAATCT
TGGCAATCACTACGACCCCACTACCGGCAAGTTCAGCTGCCAGGTGCGGGGCATCTACTTCTTC
ACGTACCACATCCTCATGCGTGGCGGCGACGGAACCAGCATGTGGGCGGATCTCTGCAAGAACG
GGCAGGTGCGTGCCAGCGCCATAGCCCAGGACGCGGACCAGAATTATGACTACGCCAGCAACAG
CGTGGTCCTGCACCTGGATTCGGGCGATGAGGTCTATGTGAAGTTGGACGGCGGGAAGGCGCAC
GGGGGCAACAACAACAAGTACAGCACGTTCTCGGGCTTTCTCCTGTATCCGGATTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099419	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL87942	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066827.4
GenBank Protein	SOR70293	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001099419 ⟸ NM_001105949
- Peptide Label:	precursor
- UniProtKB:	M0RB98 (UniProtKB/TrEMBL), A0A9K3Y724 (UniProtKB/TrEMBL), A0A3B0IP42 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYTVSPAGGPAGAKAPPPGPSTAALEVMQD LSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGG VGVVGGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTT GKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSG DEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD hide sequence

Ensembl Acc Id:

ENSRNOP00000066827 ⟸ ENSRNOT00000071305

Protein Domains

C1q

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RB98-F1-model_v2	AlphaFold	M0RB98	1-257	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1594583	AgrOrtholog
BioCyc Gene	G2FUF-18505	BioCyc
Ensembl Genes	ENSRNOG00000046863	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000071305.4	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/TrEMBL
InterPro	C1q	UniProtKB/TrEMBL
	Cerebellin_Synaptic_Org	UniProtKB/TrEMBL
	Tumour_necrosis_fac-like_dom	UniProtKB/TrEMBL
KEGG Report	rno:288979	UniProtKB/TrEMBL
NCBI Gene	288979	ENTREZGENE
PANTHER	CEREBELLIN-RELATED	UniProtKB/TrEMBL
	COMPLEMENT C1Q-LIKE PROTEIN 2	UniProtKB/TrEMBL
Pfam	C1q	UniProtKB/TrEMBL
PhenoGen	C1ql2	PhenoGen
PRINTS	COMPLEMNTC1Q	UniProtKB/TrEMBL
PROSITE	C1Q	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000046863	RatGTEx
SMART	C1Q	UniProtKB/TrEMBL
Superfamily-SCOP	TNF_like	UniProtKB/TrEMBL
UniProt	A0A3B0IP42	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y724	ENTREZGENE, UniProtKB/TrEMBL
	M0RB98	ENTREZGENE
UniProt Secondary	M0RB98	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-13	C1ql2	complement C1q like 2	C1ql2	complement component 1, q subcomponent-like 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	C1ql2	complement component 1, q subcomponent-like 2	LOC288979	similar to Cerebellin-2 precursor (Cerebellin-like protein)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC288979	similar to Cerebellin-2 precursor (Cerebellin-like protein)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message